Recombinant Burkholderia ambifaria Lipase chaperone (lifO)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Burkholderia ambifaria Lipase Chaperone (lifO) is a specialized protein critical for the folding and activation of lipases in Burkholderia species. Lipases are hydrolytic enzymes essential for lipid metabolism, but their functional maturation in Gram-negative bacteria often requires chaperones like lifO to achieve an active, protease-resistant conformation . The recombinant form of lifO enables scalable production and research into its biochemical roles and industrial applications.

Mechanism of Action

  • lifO assists lipase folding by overcoming energetic barriers in the folding pathway, enabling the enzyme to adopt its native conformation .

  • Unlike typical chaperones that prevent misfolding, lifO interacts with near-native lipase structures to finalize activation .

Table 1: Functional Comparison of lifO Across Burkholderia Species

SpeciesGene IDHost SystemPurity (%)Key Role
B. ambifariaBamMC406_3810E. coli≥85Lipase activation
B. glumaelipBYeast/Cell-Free≥85Steric chaperoning
B. vietnamiensisBcep1808_4393Mammalian Cells≥85Foldase activity

Recombinant Expression Systems

  • Hosts: E. coli, yeast (Pichia pastoris), baculovirus-insect cells, and mammalian systems .

  • Yield: ≥85% purity via SDS-PAGE, with optimized buffers (e.g., Tris-based + 50% glycerol) .

Key Cloning Strategies

  • Tags: His-tag or GST-tag for affinity chromatography .

  • Storage: Stable at -80°C; avoid repeated freeze-thaw cycles .

Stability and Interactions

  • Thermostability: Refolded lipase-lifO complexes exhibit higher thermal stability than lipase alone .

  • Binding Affinity: Direct interaction with lipase confirmed via protease-protection assays and affinity chromatography .

Functional Assays

  • Circular Dichroism (CD): Demonstrates lifO's role in transitioning lipase to a catalytically active state .

  • Enzymatic Activity: lifO-dependent lipase activation measured using triglyceride hydrolysis assays .

Industrial Enzymes

  • Biofuel Production: Enhances lipase efficiency in transesterification reactions for biodiesel synthesis .

  • Detergent Industry: Stabilizes lipases in harsh detergent formulations .

Medical and Pharmaceutical Research

  • Antifungal Agents: Burkholderia lipase systems (regulated by lifO) contribute to antifungal metabolites like occidiofungin .

  • Pathogen Studies: lifO homologs in B. cenocepacia and B. multivorans are linked to virulence in cystic fibrosis .

Research Gaps and Future Directions

  • Structural Resolution: Full crystallographic data for B. ambifaria lifO remains unpublished.

  • Engineering: Optimizing lifO for thermophilic lipases could expand industrial utility .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lifO; BamMC406_3810; Lipase chaperone; Lipase activator protein; Lipase foldase; Lipase helper protein; Lipase modulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
lifO
Target Protein Sequence
MTAREGRAPLVRRVAVYGAVGLAAIAGVAIWSGAASHRGADTARLSADAAARDGASAASP PPALPASAGLPAPLAGSSAPRLPLDAGGHLAKSRAVRDFFDYCLSARSDLSATALDALVV RGIAAQLDGTIAQPEALDVWHRYRAYLDALAKLPDAGAVDKSDLGALQLALDQRVSIAYR TLGDWSQPFFGAEQWRQRYDLARLKIAQDRTLTEAQKAERLAALAQQMPADERAARQKAD RQQAAIDQIAQLQKSGATPDAMRAQLTQTLGPDAAARVAQMQQDDASWQSRYADYAAQRA QIDAAGLSPQDRDAQIASLRQRMFTKPGEAVRAASLDRGAAAAR
Uniprot No.

Target Background

Function
Potentially involved in the periplasmic folding of extracellular lipase.
Database Links
Protein Families
Lipase chaperone family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia ambifaria Lipase chaperone (lifO) and what is its primary function?

Lipase chaperone (lifO) in Burkholderia ambifaria is a molecular chaperone protein that assists in the proper folding of lipase enzymes. Based on studies of related Burkholderia species, lifO (also known as lipase foldase) is essential for lipase to adopt its catalytically active conformation. The chaperone helps the lipase overcome an energetic barrier in the productive folding pathway, rather than preventing it from entering a non-productive pathway . Without the chaperone, the lipase can fold into a structurally similar but enzymatically inactive conformation, highlighting that the amino acid sequence of lipase alone does not contain all the information required for the protein to adopt its functional three-dimensional structure .

How does the structure-function relationship of lifO contribute to lipase activation?

The structure-function relationship of lifO is characterized by its ability to form a 1:1 complex with lipase, as demonstrated in studies with Pseudomonas cepacia (now classified as Burkholderia cepacia) . The interaction between lifO and lipase is specific and occurs late in the folding process, as evidenced by protease-protection experiments and affinity chromatography . This interaction is crucial for converting the inactive lipase into its active conformation. The chaperone appears to function analogously to propeptides of many bacterial proteases, suggesting a conserved mechanism across different bacterial enzyme systems .

What are the genetic aspects of the lipase-lifO system?

In Burkholderia species, the lipase gene (lipA) requires a downstream gene (lifO, also known as limA or lipB) for the expression of lipase activity . These genes are typically arranged in an operon structure, facilitating coordinated expression. This genetic arrangement ensures that the chaperone is available when the lipase is being synthesized, allowing for proper folding and activation in the periplasmic space prior to secretion. Genetic studies have confirmed that without lifO/limA, functional lipase activity cannot be achieved even if the lipase protein itself is expressed .

What expression systems are optimal for producing recombinant B. ambifaria lifO?

Based on research with related Burkholderia species, Escherichia coli expression systems can be used for recombinant production of lifO. For optimal expression, consider using E. coli strains designed for periplasmic expression, as lifO naturally functions in the periplasmic space of Gram-negative bacteria . When designing expression constructs, inclusion of a His-tag can facilitate purification while maintaining functionality, as demonstrated with the periplasmic domain (amino acids 44-353) of B. glumae lifO . Expression should be optimized at lower temperatures (16-25°C) to enhance proper folding and reduce inclusion body formation.

How can researchers confirm the functionality of recombinant lifO preparations?

Functionality of recombinant lifO can be assessed through in vitro refolding assays. This involves:

  • Denaturing purified lipase using 8M urea

  • Removing the denaturant through dialysis in the presence and absence of lifO

  • Measuring lipase activity using standard lipase assays (e.g., p-nitrophenyl ester hydrolysis)

A successful lifO preparation will show significantly higher reactivation of lipase compared to samples refolded without lifO . Additionally, complex formation between lifO and lipase can be confirmed using techniques such as co-immunoprecipitation with anti-lipase or anti-lifO antibodies, as demonstrated with B. cepacia LimA and lipase .

What are the optimal storage conditions for recombinant lifO preparations?

Based on commercial recombinant lifO products from related Burkholderia species, the following storage conditions are recommended:

Storage PurposeTemperatureBuffer CompositionDuration
Long-term storage-20°C to -80°CTris-based buffer with 50% glycerolMonths to years
Working aliquots4°CTris-based bufferUp to one week

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity . For optimal stability, the storage buffer should be optimized specifically for the protein, typically maintaining pH 7.5-8.0 with sufficient ionic strength to prevent aggregation.

How does the interaction between lipase and lifO differ from other molecular chaperone systems?

Unlike general molecular chaperones (e.g., GroEL/ES) that interact transiently with multiple substrates, lifO forms a specific 1:1 complex with its cognate lipase . Studies with B. glumae have shown that lifO functions late in the folding process, helping lipase overcome an energetic barrier to reach its active conformation . This mechanism differentiates lifO from general chaperones that typically prevent misfolding or aggregation during early folding stages.

Another distinctive feature is that lipase refolded without lifO adopts a native-like conformation that is more thermostable than the native form but enzymatically inactive, suggesting that lifO induces a conformational change rather than preventing misfolding . This contrasts with many other chaperone systems where the absence of the chaperone leads to aggregation or completely misfolded structures.

What structural elements of lipase are recognized by lifO during the folding process?

Structural studies suggest that lifO recognizes specific elements in the lipase structure that are critical for catalytic activity. Based on research with related Burkholderia species, lifO likely interacts with regions near the catalytic triad of the lipase, facilitating the formation of the active site architecture. The recognition may involve both the folded core of the lipase and specific surface-exposed regions.

The lipase can fold into a structurally similar but inactive conformation without lifO, indicating that subtle structural differences, possibly in the active site region or the lid domain that controls substrate access, are influenced by lifO interaction . Site-directed mutagenesis studies focusing on residues at the predicted interface between lipase and lifO would be valuable for identifying specific recognition elements.

How can advanced biophysical techniques be applied to study lifO-lipase interactions?

Several advanced biophysical techniques can provide insights into lifO-lipase interactions:

  • Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of both proteins that become protected upon complex formation, revealing interaction interfaces.

  • Surface Plasmon Resonance (SPR): SPR can determine binding kinetics and affinities between lipase and lifO under various conditions.

  • Cryo-Electron Microscopy: This approach can potentially resolve the structure of the lipase-lifO complex, providing atomic-level details of the interaction.

  • Circular Dichroism (CD): As demonstrated with B. glumae lipase, CD can detect conformational changes in lipase structure with and without lifO, helping understand how lifO influences lipase folding .

  • Isothermal Titration Calorimetry (ITC): ITC can provide thermodynamic parameters of the lipase-lifO interaction, offering insights into the energetics of complex formation.

What approaches can be used to study the kinetics of lifO-mediated lipase folding?

The kinetics of lifO-mediated lipase folding can be studied using the following methodological approaches:

  • Time-resolved refolding assays: Monitor lipase activity recovery at different time points after initiating refolding in the presence of lifO. This can be performed by taking aliquots from a refolding reaction and measuring lipase activity.

  • Stopped-flow circular dichroism: This technique allows real-time monitoring of secondary structure formation during refolding, providing insights into structural transitions induced by lifO.

  • Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or extrinsic fluorescent probes to monitor conformational changes during refolding in real-time.

  • Pulse-chase experiments: Begin refolding without lifO, then add lifO at different time points to determine when the lipase becomes committed to an inactive folding pathway versus when it can still be rescued by lifO .

These approaches should be complemented with controls involving denatured lipase refolded without lifO to establish baseline folding kinetics in the absence of the chaperone.

How can researchers investigate the specificity of lifO across different Burkholderia species?

To investigate lifO specificity across Burkholderia species, researchers can employ cross-species complementation studies:

  • Heterologous expression systems: Express lipase from one Burkholderia species (e.g., B. ambifaria) with lifO from another species (e.g., B. cepacia or B. glumae) and measure lipase activity.

  • Domain swapping experiments: Create chimeric lifO proteins containing domains from different Burkholderia species to identify regions responsible for species-specific recognition.

  • Sequence analysis and structure prediction: Compare amino acid sequences of lifO from different Burkholderia species to identify conserved and variable regions that might contribute to specificity.

  • In vitro refolding assays: Compare the efficiency of lipase reactivation using lifO proteins from different Burkholderia species to quantify cross-species compatibility.

This research could reveal evolutionary relationships between these chaperones and provide insights into the co-evolution of lipase and lifO in different Burkholderia species.

What methods can be used to characterize post-translational modifications of recombinant lifO?

To characterize potential post-translational modifications of recombinant lifO:

  • Mass spectrometry (LC-MS/MS): This technique can identify and localize modifications such as phosphorylation, glycosylation, or proteolytic processing.

  • 2D gel electrophoresis: This approach can separate protein isoforms resulting from different post-translational modifications.

  • Western blotting with modification-specific antibodies: If common modifications are suspected, antibodies against specific modifications can be used.

  • Site-directed mutagenesis: Mutating potential modification sites and assessing impact on lifO function can confirm the importance of specific modifications.

  • Enzymatic deglycosylation or dephosphorylation: Treating recombinant lifO with enzymes that remove specific modifications followed by functional assays can reveal their importance.

These analyses are particularly important when comparing recombinant lifO produced in heterologous systems to native lifO, as differences in post-translational modification machinery can affect protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.