Recombinant Burkholderia ambifaria Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requirements in your order notes and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; BamMC406_2431; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
lspA
Target Protein Sequence
MAKTLSKPASGALAPWLGISLIVILFDQLSKIAILKTFAYGAQHALTSFFSLVLVYNRGA AFGFLSTASGWQRWAFTALGIGATLVICFLLRRHGQQRLFSLSLALILGGALGNVIDRLV YGHVIDFLDFHVGGWHFPAFNLADSAITVGAVLLVYDELRRVRGSR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of lipoprotein signal peptidase (lspA) in Burkholderia ambifaria?

Lipoprotein signal peptidase (lspA) in B. ambifaria encodes Type II Signal Peptidase (SPase II), which is essential for lipoprotein processing in gram-negative bacteria. This enzyme functions by cleaving the signal peptide from prolipoproteins after they have been modified by prolipoprotein diacylglyceryl transferase (Lgt). This processing is critical for proper lipoprotein localization and function in the bacterial cell membrane. Research in related species like Rickettsia typhi has demonstrated that SPase II contains highly conserved residues and domains essential for lipoprotein processing activity .

How does lspA expression vary during different stages of bacterial growth and infection?

Studies in related bacterial species have shown that lspA expression follows a specific pattern during bacterial growth cycles. Transcriptional analysis using real-time quantitative reverse transcription-PCR reveals differential expression during various stages of intracellular growth. Typically, there is higher transcriptional activity at preinfection time points, followed by a decrease until approximately 8 hours post-infection. After bacterial doubling time, expression increases and often peaks around 48 hours post-infection, decreasing again as host cells begin to lyse. This pattern suggests that lspA plays specific roles at different stages of infection and growth .

What is the relationship between lspA and other protein secretion genes?

The lspA gene works in concert with other protein secretion genes, particularly lgt (encoding prolipoprotein transferase) and lepB (encoding type I signal peptidase). While lspA and lgt show similar expression patterns due to their involvement in lipoprotein processing, lepB typically demonstrates higher expression levels, suggesting it functions as the major signal peptidase for protein secretion. In silico predictions from related species indicate that of all secretory proteins with signal peptides, only a small fraction (approximately 15-16%) are lipoproteins, explaining why lepB expression often exceeds that of lspA and lgt .

What are the optimal conditions for expressing recombinant B. ambifaria lspA in heterologous systems?

For expressing recombinant B. ambifaria lspA in heterologous systems such as Escherichia coli, researchers should consider the following methodological approach:

  • Vector selection: Use a vector with an inducible promoter (such as pET or pBAD systems) to control expression levels.

  • Host strain: BL21(DE3) or similar strains deficient in proteases are recommended for better protein yield.

  • Expression conditions:

    • Temperature: 16-25°C (lower temperatures often improve folding of membrane proteins)

    • Induction: 0.1-0.5 mM IPTG (for T7-based systems) or 0.002-0.02% arabinose (for pBAD systems)

    • Growth phase: Induce at mid-log phase (OD600 of 0.4-0.6)

    • Duration: 4-16 hours post-induction

  • Membrane fraction isolation: Use differential centrifugation followed by detergent extraction (typically 1-2% n-dodecyl β-D-maltoside or Triton X-100).

How can the functionality of recombinant lspA be assessed through complementation assays?

Functionality of recombinant B. ambifaria lspA can be assessed through genetic complementation assays using temperature-sensitive E. coli strains with defective lspA (such as E. coli Y815). Recommended methodology includes:

  • Transform the temperature-sensitive E. coli strain with a plasmid expressing B. ambifaria lspA.

  • Growth assessment: Compare growth rates at permissive (30°C) and non-permissive (42°C) temperatures.

  • Quantification: Measure optical density over time to calculate growth rate restoration.

  • Controls: Include wild-type E. coli lspA as a positive control and empty vector as a negative control.

  • Interpretation: Successful complementation is indicated by growth restoration at the non-permissive temperature. Based on studies with R. typhi lspA, researchers should expect partial but significant complementation (approximately 20% of the rate achieved by homologous E. coli lspA complementation) .

What experimental design approaches are most appropriate for studying lspA function in vivo?

When studying lspA function in vivo, researchers should consider both experimental and quasi-experimental design approaches:

  • Randomized Controlled Trials (RCTs) can be used to test specific hypotheses about lspA function:

    • Randomize bacterial strains (wild-type vs. lspA mutants) to different treatment conditions

    • Control for confounding variables

    • Use appropriate statistical analyses for data interpretation

  • Single Subject Experimental Designs (SSEDs) may be useful for studying specific phenotypic changes:

    • Withdrawal designs to study reversible phenotypes

    • Alternating treatment designs to compare different conditions

  • Conditional knockdowns or knockouts using approaches like:

    • Inducible promoter systems

    • CRISPR interference (CRISPRi)

    • Temperature-sensitive mutants

  • Time-course experiments to track lspA activity throughout infection cycles:

    • Sample collection at multiple timepoints pre-infection and post-infection

    • Real-time qRT-PCR for transcriptional analysis

    • Proteomic analysis for protein level changes

Note that when using these approaches, it's essential to ensure proper controls and consider the specific growth characteristics of Burkholderia species, including their slower growth rates compared to model organisms like E. coli.

How can researchers identify potential lipoproteins processed by lspA in B. ambifaria?

To identify potential lipoproteins processed by lspA in B. ambifaria, researchers should employ a multi-faceted approach:

  • Bioinformatic prediction:

    • Use specialized algorithms like SignalP (v3.0 or newer) and LipoP (v1.0 or newer) to scan the B. ambifaria genome

    • Look for proteins with characteristic lipobox motifs [L/V/I]-[A/S/T/G]-[G/A]-C

    • Filter results based on predicted cellular localization

  • Comparative proteomics:

    • Compare membrane fractions from wild-type and lspA mutant strains

    • Use 2D gel electrophoresis or LC-MS/MS to identify differentially processed proteins

    • Focus on proteins that show altered mobility or localization in the mutant

  • Metabolic labeling:

    • Incorporate radiolabeled palmitate or fatty acids to track lipoprotein processing

    • Immunoprecipitate specific candidate lipoproteins

    • Compare labeling between wild-type and lspA-deficient strains

Based on studies in related bacteria, approximately 14-16 lipoproteins out of every 89 secretory proteins would be expected to be processed by lspA in B. ambifaria .

What are the key structural domains and catalytic residues of B. ambifaria lspA?

Although the specific structure of B. ambifaria lspA has not been fully characterized, based on homology with other bacterial SPase II enzymes, the following structural characteristics are predicted:

Table 1: Predicted Key Structural Elements of B. ambifaria lspA

Domain/MotifAmino Acid PositionPredicted Function
Transmembrane domain 1~25-45Membrane anchoring
Transmembrane domain 2~70-90Membrane anchoring
Transmembrane domain 3~130-150Membrane anchoring
Transmembrane domain 4~170-190Membrane anchoring
Aspartic acid (D)~128Catalytic residue, nucleophilic attack
Aspartic acid (D)~154Catalytic residue, proton transfer
Asparagine (N)~99Substrate binding
Conserved cytoplasmic loop~100-130Substrate recognition

These predictions are based on alignment of deduced amino acid sequences from related bacterial species, which show highly conserved residues and domains that are essential for SPase II activity in lipoprotein processing .

How does globomycin resistance assay provide insights into lspA functionality?

The globomycin resistance assay provides a valuable functional assessment of recombinant lspA activity. Globomycin is a cyclic peptide antibiotic that specifically inhibits SPase II, preventing lipoprotein processing and causing accumulation of prolipoproteins in the membrane, which is lethal to bacteria.

Methodological approach for globomycin resistance assay:

  • Preparation:

    • Transform E. coli with recombinant B. ambifaria lspA expression constructs

    • Include appropriate controls (empty vector, E. coli native lspA)

  • Resistance testing:

    • Prepare serial dilutions of globomycin (typically 1-100 μg/ml)

    • Grow transformed bacteria in media containing different globomycin concentrations

    • Monitor growth over 24-48 hours

  • Data analysis:

    • Determine minimum inhibitory concentration (MIC) for each strain

    • Calculate fold increase in resistance compared to control strains

  • Interpretation:

    • Increased globomycin resistance indicates functional SPase II activity

    • The level of resistance correlates with the amount of active enzyme

It's important to note that globomycin binding to SPase II and the processing of prolipoprotein by SPase II are two independent cellular activities, meaning that resistance to globomycin may not perfectly correlate with complementation efficiency in growth assays .

How does B. ambifaria lspA compare to lspA in other Burkholderia species?

When comparing B. ambifaria lspA to lspA in other Burkholderia species, researchers should consider several key aspects:

Understanding these comparative aspects is particularly important as studies with near-neighbor species are informative about the diversity of protein processing mechanisms in Burkholderia and can provide clues about evolutionary adaptations to different lifestyles (e.g., environmental versus pathogenic) .

What insights can be gained from comparing lspA function between pathogenic and non-pathogenic Burkholderia species?

Comparative analysis of lspA between pathogenic and non-pathogenic Burkholderia species can yield important insights:

  • Contribution to virulence: By comparing how lspA processes lipoproteins in pathogenic species (e.g., B. pseudomallei, B. mallei) versus environmental species (e.g., B. ambifaria, B. thailandensis), researchers can identify specific lipoproteins that may contribute to virulence.

  • Host adaptation: Differences in lspA activity or regulation may reflect adaptations to different host environments or transition from environmental to pathogenic lifestyles.

  • Evolutionary pressure: Sequence analysis can reveal whether lspA is under different selective pressures in pathogenic versus non-pathogenic species.

  • Regulatory networks: Comparison of transcriptional responses across species can reveal how lspA regulation has been incorporated into different virulence regulatory networks.

  • Therapeutic targeting potential: If lspA function is more critical for pathogenic species, it may represent a potential target for antimicrobial development with reduced impact on beneficial environmental Burkholderia .

This comparative approach can be particularly valuable for understanding the evolution of pathogenicity within the Burkholderia genus and identifying conserved versus specialized functions of lspA.

What are the most effective methods for creating lspA deletion mutants in B. ambifaria?

Creating lspA deletion mutants in B. ambifaria requires specialized approaches due to the inherent antibiotic resistance and genetic manipulation challenges of Burkholderia species:

  • Allelic exchange using suicide vectors:

    • Construct a deletion plasmid containing upstream and downstream regions of lspA fused together

    • Use suicide vectors like pEX18Tc or pJQ200SK that cannot replicate in Burkholderia

    • Select for single crossover integration using appropriate antibiotics

    • Counter-select using sucrose sensitivity (sacB) for double crossover events

    • Verification by PCR and sequencing

  • CRISPR-Cas9 based approaches:

    • Design sgRNAs targeting lspA

    • Provide repair templates with homology arms (500-1000 bp)

    • Use codon-optimized Cas9 for Burkholderia

    • Special consideration: lower transformation efficiency may require optimization

  • Conditional knockdown alternatives:

    • If lspA is essential, consider inducible antisense RNA systems

    • Rhamnose or arabinose-inducible promoters can be effective in Burkholderia

    • Temperature-sensitive mutants may also be viable alternatives

  • Verification strategies:

    • PCR confirmation with primers flanking the deleted region

    • RT-PCR to confirm absence of transcript

    • Western blotting to confirm absence of protein

    • Functional verification through altered lipoprotein processing

Note that if lspA is essential in B. ambifaria as it is in many gram-negative bacteria, complete deletion may not be viable, and conditional approaches may be necessary.

How can transcriptomic analysis be used to understand the global effects of lspA disruption?

Transcriptomic analysis provides powerful insights into the global effects of lspA disruption in B. ambifaria:

  • Experimental design considerations:

    • Compare wild-type to conditional lspA mutants or knockdowns

    • Sample at multiple time points during growth and/or infection

    • Include relevant stress conditions to identify condition-specific effects

    • Use biological replicates (minimum n=3) for statistical power

  • RNA-Seq methodology:

    • Total RNA extraction with specialized protocols for Burkholderia

    • rRNA depletion for improved mRNA coverage

    • Strand-specific library preparation

    • Deep sequencing (>20 million reads per sample)

    • Bioinformatic analysis using Burkholderia-specific pipelines

  • Data analysis approach:

    • Differential expression analysis (DESeq2 or EdgeR)

    • Gene Ontology and pathway enrichment analysis

    • Regulon analysis to identify co-regulated genes

    • Integration with existing Burkholderia transcriptomic datasets

  • Validation of key findings:

    • qRT-PCR for selected genes

    • Protein-level confirmation for key findings

    • Phenotypic assays to connect transcriptomic changes to cellular functions

Based on studies of related secretion systems, researchers should expect to observe changes in genes related to membrane stress responses, protein folding and quality control, cell envelope maintenance, and potentially virulence factors dependent on proper lipoprotein processing .

What factors should be considered when designing experiments to study the role of lspA in B. ambifaria pathogenesis?

When designing experiments to study the role of lspA in B. ambifaria pathogenesis, researchers should consider:

  • Model system selection:

    • In vitro: Human or animal cell lines relevant to natural infection routes

    • Ex vivo: Primary cell cultures or tissue explants

    • In vivo: Appropriate animal models (typically murine models for respiratory infection)

    • Plant models: If studying plant-associated phenotypes of B. ambifaria

  • Experimental design approaches:

    • Randomized controlled trials for specific hypothesis testing

    • Single subject experimental designs for specific phenotypic changes

    • Time-course experiments to track changes throughout infection

  • Key parameters to measure:

    • Bacterial survival and replication within host cells/tissues

    • Host immune response markers

    • Biofilm formation capacity

    • Secretion of virulence factors

    • Host cell/tissue damage markers

  • Controls and validations:

    • Complemented mutants to confirm phenotypes are due to lspA disruption

    • Comparison with other secretion system mutants to differentiate specific effects

    • Dose-response relationships to ensure observed effects are physiologically relevant

  • Technical considerations:

    • Burkholderia species generally grow more slowly than model organisms

    • B. ambifaria may require BSL-2 containment depending on the strain

    • Consider antibiotic selection carefully due to intrinsic resistance profiles

By carefully considering these factors, researchers can design robust experiments that provide meaningful insights into the role of lspA in B. ambifaria pathogenesis and host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.