Recombinant Burkholderia ambifaria Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yidC; BamMC406_3099; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRSHGRPSMFFPSATQTAPAAAGGASGTGATTTTAGE VPAAAAGTAPSTTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITL FDHTAGHTYLARTGLLGGDFPNHNDVYTQVNAGPTSLTGDQNALKLSFESPVKGGVKVVK TYTFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKH FQKIDFSDLDKNKANFEKAADNGWVAMVQHYFASAWIPQQGAKRDIYAEKIDPALYRVGV KQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIH GFVGNWGWAIVLLTVLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAAL MELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPFFILP VLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQY YITRKLGGVKKKPA
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC is involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, and some lipoproteins. It also facilitates the folding of multispanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in Burkholderia species?

YidC is a prominent membrane protein insertase belonging to the Oxa1 superfamily, essential for bacterial inner membrane biogenesis. In Burkholderia species, as in other bacteria, YidC significantly influences membrane protein composition and lipid organization. It serves dual functions: (1) interacting with the Sec translocon to aid proper folding of multi-pass membrane proteins, and (2) functioning independently as both an insertase and lipid scramblase to facilitate insertion of smaller membrane proteins while contributing to bilayer organization . This versatility makes YidC crucial for maintaining membrane integrity in Burkholderia species.

How is YidC structurally characterized and what are its conserved features across bacterial species?

YidC features a conserved structure characterized by a membrane-exposed hydrophilic groove that facilitates the translocation of membrane proteins into the lipid bilayer . This structural groove is linked to a membrane bilayer thinning mechanism that likely reduces the energy required for protein translocation . Importantly, this groove is also implicated in inter-leaflet membrane lipid scramblase activity, a characteristic trait of the membrane insertase family . The dual functionality of protein insertion and lipid reorganization appears conserved across bacterial species including Burkholderia, highlighting YidC's evolutionary importance in maintaining membrane homeostasis.

What substrates does YidC typically process in Burkholderia and related bacteria?

YidC processes several well-characterized substrates, as demonstrated in research studies. These include:

YidC SubstrateTypeTM SegmentsYidC-DependencyYibN Enhancement Effect
M13 procoat proteinPhage protein1High1.5-1.8× increased insertion
Pf3 coat proteinPhage protein1High1.5-1.8× increased insertion
F0c (ATP synthase subunit c)Cellular protein2High1.5-1.8× increased insertion
SecGCellular protein2ModerateSignificant enhancement
SecG I20E mutantMutated cellular protein2ReducedMinimal enhancement
YajCCellular protein1LowNo significant effect
YhcBCellular protein1LowNo significant effect

This substrate specificity pattern is likely conserved in Burkholderia ambifaria YidC due to the high conservation of this essential protein .

What expression systems are most effective for producing recombinant Burkholderia ambifaria YidC?

For recombinant expression of membrane proteins like YidC from Burkholderia ambifaria, E. coli-based expression systems remain the gold standard due to their versatility and ease of genetic manipulation. Based on studies with related membrane proteins, the most effective approach utilizes a dual-plasmid system with tunable promoters. The pBAD expression system with arabinose induction (0.1-0.2% arabinose) has proven successful for controlled YidC expression, as demonstrated in the YidC-YibN interaction studies . For improved membrane protein yields, consider using specialized E. coli strains like C41(DE3), C43(DE3), or Lemo21(DE3) that are engineered to better accommodate membrane protein overexpression. Alternative expression systems like Lactococcus lactis may be considered if E. coli expression results in toxicity or inclusion body formation.

What are the optimal conditions for solubilizing and purifying recombinant YidC from Burkholderia ambifaria?

The purification of recombinant YidC requires careful optimization of detergent selection and membrane solubilization conditions. Based on successful approaches with related membrane insertases:

  • Membrane preparation: Harvest cells and disrupt by French press or sonication at 4°C in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitor cocktail.

  • Membrane solubilization: Solubilize isolated membranes (typically 3-5 mg/ml protein) with n-dodecyl-β-D-maltoside (DDM) at 1% concentration for 1 hour at 4°C with gentle rotation . Alternative detergents like n-decyl-β-D-maltoside (DM) or lauryl maltose neopentyl glycol (LMNG) at 1-2% may improve yields for specific applications.

  • Affinity purification: For His-tagged YidC, use Ni-NTA agarose beads with buffers containing 0.03-0.05% DDM to maintain protein solubility. Employ a stepwise imidazole gradient (20-300 mM) for elution, with the protein typically eluting at 150-250 mM imidazole .

  • Further purification: Consider size exclusion chromatography using Superdex 200 columns in buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, and 0.03% DDM for highest purity.

Protein stability can be assessed through on-gel binding assays as described for YidC-YibN interaction studies .

How can researchers verify the proper folding and functionality of recombinant YidC?

Verifying proper folding and functionality of recombinant Burkholderia ambifaria YidC involves multiple complementary techniques:

  • In vitro translation/insertion assays: Prepare inverted membrane vesicles (INVs) containing the recombinant YidC and test insertion activity using radiolabeled substrates such as Pf3 coat protein, M13 procoat, or F0c. Functional YidC will show 1.5-1.8 fold stimulation of insertion compared to control membranes .

  • Protease protection assays: After membrane insertion, treat with proteinase K and detect membrane-protected fragments (MPFs) by SDS-PAGE and autoradiography. Properly inserted substrates will generate specific MPF patterns .

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure content to confirm proper folding, with properly folded YidC showing characteristic α-helical signals.

  • Thermal shift assays: Determine protein stability using differential scanning fluorimetry with SYPRO Orange dye to establish melting temperatures.

  • Complementation assays: Test if recombinant YidC can rescue growth of YidC-depleted E. coli strains, confirming functional conservation across species.

What proteins interact with YidC in Burkholderia species and how can these interactions be characterized?

YidC in Burkholderia species likely participates in a complex protein interaction network similar to that observed in other bacteria. To characterize these interactions:

  • Proximity-dependent biotin labeling (BioID): This approach has successfully identified YibN as a crucial interactor of YidC . For Burkholderia YidC, fuse the BioID ligase to YidC and express in Burkholderia to identify proximal proteins.

  • Affinity purification-mass spectrometry (AP-MS): Use SILAC-labeled Burkholderia cultures expressing His-tagged YidC, solubilize membranes with DDM, and perform pull-downs with Ni-NTA agarose. Interacting proteins can be identified by LC-MS/MS with >20-fold enrichment over background indicating significant interactions .

  • On-gel binding assays: Use purified proteins to validate direct interactions through native PAGE followed by Western blotting to detect stable complexes .

  • Co-immunoprecipitation with SPA-tagged YidC: The sequential peptide affinity (SPA) tag approach allows for gentle purification of native complexes from chromosomally tagged strains .

In E. coli, YidC interacts with the Sec translocon, protease FtsH, regulatory partners HflC and HflK, and the recently identified YibN . A similar interaction network is expected in Burkholderia species, with potential genus-specific interactors that could be identified through comparative studies.

What is the significance of the recently discovered YibN-YidC interaction and is this likely conserved in Burkholderia ambifaria?

The YibN-YidC interaction represents a significant advance in understanding membrane protein biogenesis. This interaction:

  • Enhances membrane protein biogenesis: YibN significantly increases the production and membrane insertion of YidC substrates such as M13 procoat, Pf3 coat protein, ATP synthase subunit c, and SecG . In vitro assays with inverted membrane vesicles (INVs) demonstrated that YibN-enriched membranes supported 1.5-1.8-fold stimulation of substrate insertion .

  • Modulates lipid organization: YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC's lipid scramblase activity . This suggests that YibN may regulate YidC's dual role in protein insertion and lipid organization.

  • Depends on transmembrane interactions: The interaction relies on YibN's N-terminal transmembrane segment, indicating that the association occurs within the hydrophobic interior of the lipid bilayer .

The conservation of this interaction in Burkholderia ambifaria would need to be confirmed experimentally, but given that YidC is highly conserved and that the YidC-YibN interaction appears to be fundamentally important for membrane protein biogenesis, it is likely that Burkholderia species employ similar protein partnerships. Homology searches for YibN homologs in Burkholderia genomes and subsequent co-purification studies would be needed to confirm this hypothesis.

How can researchers design in vitro assays to measure YidC insertase activity using recombinant Burkholderia ambifaria YidC?

Designing robust in vitro assays for measuring YidC insertase activity requires careful preparation of components and optimization of reaction conditions:

  • Preparation of inverted membrane vesicles (INVs):

    • Express recombinant B. ambifaria YidC in E. coli or native Burkholderia

    • Harvest cells in mid-log phase and disrupt by French press

    • Collect membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

    • Resuspend membranes in buffer containing 50 mM HEPES-KOH pH 7.5, 250 mM sucrose, 100 mM KOAc

  • In vitro translation setup:

    • Prepare an S-30 extract from E. coli or Burkholderia for coupled transcription-translation

    • Include 35S^35S-methionine for radioactive labeling of synthesized proteins

    • Use plasmids encoding YidC substrates (M13 procoat, Pf3 coat, F0c, or SecG)

  • Insertion assay protocol:

    • Mix S-30 extract, appropriate buffers, amino acids, energy sources, and template DNA

    • Add INVs (containing either recombinant YidC or control membranes)

    • Incubate at 37°C for 30 minutes

    • Split sample for total protein analysis and protease protection assay

    • For protease protection, treat with proteinase K (0.5 mg/ml) for 20 minutes at 25°C

    • Stop reaction with TCA precipitation

    • Analyze by SDS-PAGE and autoradiography/phosphorimaging

  • Quantification and controls:

    • Measure insertion efficiency by quantifying membrane-protected fragments (MPFs)

    • Compare insertion efficiency with YidC-enriched INVs versus control INVs

    • Include SecG I20E mutant as a control for specificity

    • Use YajC or YhcB as negative controls that should show minimal YidC dependence

Functional recombinant YidC should show a 1.5-1.8-fold stimulation of insertion compared to control membranes, similar to what has been observed with YibN-enriched membranes .

What approaches can be used to investigate YidC's role in lipid scramblase activity in Burkholderia species?

YidC's recently discovered role as a lipid scramblase represents an exciting area for investigation in Burkholderia species. Several approaches can be employed:

  • Fluorescent lipid analog assays:

    • Reconstitute purified recombinant YidC into liposomes

    • Incorporate NBD-labeled phospholipids (e.g., NBD-PC) exclusively in the outer leaflet

    • Monitor fluorescence dequenching over time as NBD-lipids flip to the inner leaflet

    • Compare scrambling rates between proteoliposomes containing active YidC versus denatured controls

  • Mass spectrometry-based approaches:

    • Prepare asymmetric liposomes with distinct lipid compositions in inner and outer leaflets

    • Add purified YidC and incubate for varying time periods

    • Extract and analyze lipids by LC-MS/MS to quantify changes in leaflet composition

    • Use deuterated or otherwise labeled lipids to track movement between leaflets

  • Indirect measures through membrane morphology:

    • Overexpress YidC in Burkholderia cells and monitor membrane structural changes

    • Use transmission electron microscopy to assess membrane proliferation and morphological changes similar to those observed with YibN overproduction

    • Quantify changes in specific lipid species using lipidomics approaches

  • Genetic approaches:

    • Generate YidC variants with mutations in the hydrophilic groove region

    • Assess both protein insertion and lipid scrambling activities

    • Identify mutations that differentially affect these two functions to determine if they are mechanistically distinct

Recent research suggests that YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity . This provides an experimental entry point for investigating the relationship between YidC's insertase and scramblase functions in Burkholderia species.

How can researchers differentiate between YidC-dependent and Sec-dependent membrane protein insertion pathways in Burkholderia?

Differentiating between YidC-dependent and Sec-dependent insertion pathways requires experimental approaches that can selectively inhibit or monitor each pathway:

  • Conditional depletion approaches:

    • Create strains with inducible promoters controlling YidC or SecY expression

    • Monitor insertion of various substrates under depletion conditions

    • Classify substrates based on insertion efficiency under different depletion conditions

    Substrate CategoryYidC Depletion EffectSecY Depletion EffectInsertion Pathway
    Type ISeverely reducedMinimal effectYidC-only
    Type IIModerately reducedSeverely reducedSec-YidC cooperative
    Type IIIMinimal effectSeverely reducedSec-only
    Type IVMinimal effectMinimal effectAlternative pathway
  • In vitro reconstitution:

    • Prepare INVs from strains depleted for either YidC or SecY

    • Test insertion of model substrates such as Pf3 coat (YidC-dependent), M13 procoat (YidC/Sec-dependent), or OmpA (Sec-dependent)

    • Complement with purified components to restore activity

  • Crosslinking approaches:

    • Use site-specific crosslinkers on nascent chains during membrane insertion

    • Identify crosslinked partners by immunoprecipitation and Western blotting

    • Determine whether substrates primarily crosslink to YidC, SecY, or both during insertion

  • Substrate mutations:

    • Generate mutations in the hydrophobic regions of substrate proteins

    • Mutations like SecG I20E that reduce hydrophobicity often shift dependence from YidC to Sec pathway

    • Systematically analyze how these mutations affect pathway dependence

  • Energy requirements:

    • YidC-only insertion is typically less energy-dependent than Sec-dependent insertion

    • Monitor insertion efficiency under ATP-depleted conditions (with inhibitors like CCCP)

    • YidC-dependent substrates should show greater resistance to energy depletion

These approaches can be particularly informative when applied to Burkholderia-specific membrane proteins of interest, potentially revealing unique aspects of membrane protein biogenesis in this genus compared to model organisms like E. coli.

What evolutionary insights have emerged from comparative studies of YidC across bacterial species, and how might this inform research on Burkholderia ambifaria YidC?

Recent evolutionary analyses have revealed intriguing insights about YidC that could inform Burkholderia research:

  • Unified evolutionary origin with SecY: Evidence suggests that SecY originated as a YidC homolog which formed a channel by juxtaposing two hydrophilic grooves in an antiparallel homodimer . This evolutionary relationship suggests that YidC represents an ancient and fundamental component of membrane protein biogenesis systems.

  • Conservation across the Oxa1 superfamily: YidC belongs to the broader Oxa1 superfamily, which includes functionally analogous proteins like EMC3, TMCO1, GET1, and Oxa1L . This conservation across domains of life underscores the fundamental importance of these insertases in cellular biology.

  • Structural conservation amid sequence divergence: Despite sequence variations, the hydrophilic groove structure is highly conserved across bacterial species. For Burkholderia ambifaria YidC, this suggests that structural studies from model organisms likely provide relevant insights into its function.

  • Genus-specific adaptations: Given the unique membrane composition and environmental adaptations of Burkholderia species, comparative genomics approaches could reveal genus-specific sequence motifs or regulatory elements that have evolved to optimize YidC function in these bacteria.

  • Co-evolution with interaction partners: The discovery of YibN as a YidC partner opens questions about whether such partnerships are conserved across species or represent lineage-specific adaptations. Analyzing genomic context and co-occurrence patterns of YidC and potential partners across Burkholderia species could reveal co-evolutionary relationships.

Future research on Burkholderia ambifaria YidC should consider these evolutionary insights, particularly when selecting conserved domains for mutagenesis studies or designing chimeric proteins to investigate functional conservation.

How do biofilm formation and antimicrobial resistance in Burkholderia species relate to YidC function?

The relationship between biofilm formation, antimicrobial resistance, and YidC function in Burkholderia represents an important area for investigation:

  • Proteome rewiring during biofilm formation: Temporal proteomic profiling reveals that Burkholderia undergoes significant proteome rewiring during biofilm formation, with decreased abundance of metabolic proteins and increased abundance of stress-related proteins . As a crucial membrane protein insertase, YidC likely plays a key role in this proteome remodeling by facilitating the insertion of biofilm-specific membrane proteins.

  • Stress response proteins in biofilms: Biofilm states show increased abundance of stress-related proteins . YidC may be critical for inserting these stress-response membrane proteins that contribute to the enhanced resilience of biofilm communities.

  • Antibiotic tolerance mechanisms: Proteomic analysis of Burkholderia thailandensis revealed that protein abundance changes in biofilms, including outer periplasmic TolB protein and exopolyphosphatase, facilitate antibiotic tolerance through non-specific mechanisms . YidC likely contributes to this tolerance by ensuring proper insertion of these protective membrane proteins.

  • Membrane integrity and permeability: YidC's dual role as both an insertase and lipid scramblase suggests it may influence membrane permeability barriers that affect antibiotic penetration. Altered YidC expression or activity during biofilm formation could contribute to the modified membrane properties that characterize biofilm cells.

  • Potential therapeutic target: Given YidC's essentiality and its likely role in establishing biofilm-associated antimicrobial resistance, it represents a potential target for anti-biofilm therapies. Inhibitors that specifically target YidC function could potentially sensitize Burkholderia biofilms to conventional antibiotics.

Experimental approaches to investigate these connections could include comparing YidC expression and activity between planktonic and biofilm states, assessing how YidC depletion affects biofilm formation and antibiotic susceptibility, and identifying biofilm-specific YidC substrates through comparative proteomics.

What technological advances are enabling new insights into YidC structure and function, and how can researchers apply these to studies of Burkholderia ambifaria YidC?

Recent technological advances are revolutionizing our understanding of membrane protein insertases like YidC:

  • Cryo-electron microscopy (cryo-EM) advances:

    • Near-atomic resolution structures of membrane protein complexes are now achievable

    • Researchers can visualize YidC in different functional states and with various interaction partners

    • Application to Burkholderia YidC could reveal species-specific structural features and interaction interfaces

    • Particularly valuable for capturing the YidC-YibN complex or YidC-Sec translocon assemblies

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, cryo-EM, NMR, and computational modeling

    • Provides comprehensive structural insights when individual techniques have limitations

    • Particularly useful for dynamic regions of YidC that may adopt multiple conformations

    • Can reveal how Burkholderia-specific sequence variations manifest structurally

  • Advanced mass spectrometry techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Native mass spectrometry to analyze intact membrane protein complexes

    • Particularly valuable for mapping the YidC interactome in Burkholderia

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during insertion

    • Optical tweezers to measure forces during membrane protein insertion

    • Could reveal mechanistic details of how Burkholderia YidC facilitates protein insertion

  • Genome editing with CRISPR-Cas9:

    • Precise engineering of Burkholderia genomes to study YidC variants

    • Creation of conditional depletion strains for functional studies

    • Tagging endogenous YidC for localization and interaction studies

    • Particularly useful for studying YidC in the native Burkholderia cellular context

  • Proximity labeling approaches:

    • BioID and TurboID for mapping protein neighborhoods in living cells

    • APEX2 for spatially and temporally resolved proximity mapping

    • Successfully applied to identify YibN as a YidC interactor

    • Could reveal Burkholderia-specific YidC interaction networks

Researchers studying Burkholderia ambifaria YidC should leverage these technologies, particularly integrated approaches that combine structural, functional, and systems-level analyses to develop a comprehensive understanding of this essential membrane protein insertase.

What are common challenges in expressing and purifying recombinant YidC from Burkholderia species, and how can they be addressed?

Researchers working with recombinant Burkholderia YidC often encounter several challenges:

  • Low expression levels:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Optimize codon usage for expression host; use strong but tunable promoters like pBAD (0.1-0.2% arabinose); express at lower temperatures (16-25°C) for 16-24 hours; consider fusion tags like MBP that can enhance folding

  • Toxicity to expression host:

    • Challenge: Overexpression of membrane proteins can disrupt host membrane integrity

    • Solution: Use specialized E. coli strains like C41(DE3) or C43(DE3) engineered to tolerate membrane protein overexpression; maintain strict control over induction levels; consider using Lemo21(DE3) with tunable lysozyme expression to modulate T7 RNA polymerase activity

  • Protein aggregation/inclusion body formation:

    • Challenge: Membrane proteins can aggregate when overexpressed

    • Solution: Express at lower temperatures; reduce induction levels; co-express with chaperones like GroEL/GroES; consider fusion to solubility-enhancing tags

  • Inefficient membrane extraction:

    • Challenge: Incomplete solubilization from membranes

    • Solution: Screen multiple detergents (DDM, DM, LMNG); optimize detergent:protein ratio (typically 3-5:1); extend solubilization time (2-4 hours at 4°C); consider using detergent mixtures

  • Protein instability post-purification:

    • Challenge: Purified YidC may lose activity rapidly

    • Solution: Include stabilizing additives (glycerol 10-20%, cholesterol hemisuccinate); maintain constant low temperature (4°C); consider nanodiscs or amphipols for detergent-free environments; perform functional assays immediately after purification

  • Poor yield in functional assays:

    • Challenge: Purified protein may be structurally intact but functionally compromised

    • Solution: Validate function using in vitro assays with known substrates (Pf3 coat, M13 procoat) ; assess lipid requirements for activity; verify proper orientation in reconstituted proteoliposomes

  • Heterologous expression artifacts:

    • Challenge: Post-translational modifications or folding pathways may differ in expression host

    • Solution: Compare with native-purified protein where possible; consider expression in closer bacterial relatives; verify critical functional residues are conserved

Researchers should also consider using the recently identified YidC partner YibN as a co-expression target, as it has been shown to enhance YidC substrate production and insertion .

How can researchers address data inconsistencies when comparing YidC function across different experimental systems?

When investigating YidC function, researchers often encounter data inconsistencies across different experimental systems. Here are strategies to address these challenges:

  • Standardize experimental conditions:

    • Maintain consistent buffer compositions, pH, and ionic strength across experiments

    • Use identical protein:lipid ratios for in vitro reconstitution experiments

    • Standardize growth and induction conditions for in vivo studies

    • Document all experimental variables meticulously to identify potential sources of variation

  • Apply multiple complementary techniques:

    • Validate findings using both in vivo and in vitro approaches

    • For interaction studies, confirm results using multiple methods (e.g., BioID, AP-MS, and on-gel binding assays as used in YidC-YibN studies)

    • For functional studies, combine genetic approaches with biochemical assays

  • Consider membrane composition effects:

    • Lipid composition significantly affects YidC function and substrate insertion

    • In reconstitution experiments, use defined lipid mixtures that mimic native membranes

    • Consider the role of specific lipids (e.g., MPIase glycolipid has been shown to enhance YidC-dependent translocation)

    • Include lipid composition analysis when comparing results across different membrane systems

  • Account for strain-specific variations:

    • Genetic background differences can affect YidC functionality

    • Use isogenic strains where possible for comparative studies

    • When comparing across species (e.g., E. coli vs. Burkholderia), consider complementation experiments

  • Address protein partner variations:

    • The discovery of YibN as a YidC partner highlights the importance of accessory factors

    • Inconsistencies may arise from varying levels of natural partners in different experimental systems

    • Consider co-expressing identified partners in heterologous systems

  • Quantitative analysis and statistical rigor:

    • Apply appropriate statistical tests to determine significance of observed differences

    • Use technical and biological replicates (minimum n=3) for all experiments

    • Quantify insertion efficiency using multiple metrics (e.g., both protein levels and functional activity)

  • Substrate-specific considerations:

    • Different YidC substrates (M13 procoat, Pf3 coat, F0c, SecG) may show varying dependencies

    • The SecG I20E mutation demonstrates how substrate properties can alter pathway dependence

    • Always include multiple model substrates when characterizing YidC function

By systematically addressing these factors, researchers can resolve apparent inconsistencies and develop a more comprehensive understanding of YidC function across experimental systems.

How can researchers differentiate between direct and indirect effects when studying YidC function in complex cellular systems?

Distinguishing direct from indirect effects is critical when studying multifunctional proteins like YidC in complex cellular environments:

  • Temporal resolution approaches:

    • Use rapid induction/depletion systems to observe immediate versus delayed effects

    • Employ time-course experiments to establish the sequence of events following YidC perturbation

    • Early events (within minutes to hours) are more likely to represent direct effects

    • The temporal proteomic profiling approach used for Burkholderia biofilms can be adapted to study YidC depletion effects

  • In vitro reconstitution:

    • Reconstruct minimal systems with purified components to test direct interactions

    • For insertion activity, use purified YidC, ribosomes, and substrate proteins in liposomes

    • Compare results from minimal systems with those from complete cellular extracts

    • Demonstrated utility in confirming direct YidC-YibN interaction through on-gel binding assays

  • Domain-specific mutations:

    • Design mutations that affect specific YidC functions without disrupting protein stability

    • For example, mutations in the hydrophilic groove may affect insertase activity while preserving interactions

    • Differential phenotypes from specific mutations help separate distinct functions

    • The requirement of YibN's N-terminal transmembrane segment for YidC interaction illustrates this approach

  • Substrate specificity analysis:

    • Compare effects across multiple substrates with varying YidC dependence

    • Direct YidC effects should correlate with known substrate dependencies

    • Include non-YidC substrates as controls to identify system-wide indirect effects

    • The differential effects of YibN on various substrates (enhancing M13, Pf3, F0c, SecG insertion but not YajC or YhcB) exemplify this approach

  • Proximity-based approaches:

    • Use proximity labeling (BioID, APEX) to identify proteins in direct physical contact with YidC

    • The successful application of BioID to identify YibN as a YidC interactor demonstrates this strategy's value

    • Compare spatial proteomics data with functional genomics results to distinguish proximity from functional relationships

  • Genetic suppressor analysis:

    • Identify suppressors that rescue YidC depletion phenotypes

    • Direct functional partners often appear as suppressors when overexpressed

    • Map the genetic interaction network to contextualize direct versus indirect relationships

  • Integrated multi-omics approaches:

    • Combine proteomics, transcriptomics, and metabolomics data following YidC perturbation

    • Apply network analysis to distinguish primary from secondary effects

    • The proteomic analysis of Burkholderia in biofilm versus planktonic states provides a methodological template

By systematically applying these approaches, researchers can build a hierarchical model of YidC's direct functions and their broader cellular consequences in Burkholderia systems.

How might understanding YidC function in Burkholderia species contribute to developing new antimicrobial strategies?

YidC's essential role in membrane protein biogenesis presents several promising avenues for antimicrobial development:

Given Burkholderia's significant medical burden, especially in Southeast Asia and Australia, and the lack of effective vaccine options , developing YidC-targeted antimicrobials represents a promising alternative therapeutic strategy.

What potential biotechnological applications exist for recombinant YidC in membrane protein production systems?

Recombinant YidC offers several promising biotechnological applications:

  • Enhanced membrane protein production systems:

    • Co-expression of YidC with difficult-to-express membrane proteins can improve yields

    • The demonstrated enhancement of M13 procoat, Pf3 coat, F0c, and SecG production by YibN/YidC suggests a natural amplification system that could be exploited

    • Optimized expression vectors containing YidC and YibN could form the basis of enhanced production platforms

  • In vitro membrane protein synthesis:

    • Cell-free protein synthesis systems supplemented with YidC-containing proteoliposomes

    • Could enable production of toxic membrane proteins that cannot be expressed in living cells

    • Useful for structural biology applications requiring isotope labeling or unnatural amino acid incorporation

  • Membrane protein folding quality control:

    • YidC-based chaperone systems to correct misfolded membrane proteins

    • Potential applications in production of therapeutic membrane proteins like GPCRs

    • Could be combined with other chaperones for synergistic effects

  • Engineered membrane vesicles:

    • YidC-enriched bacterial membrane vesicles as delivery systems for membrane proteins

    • Applications in vaccine development, enzyme display, or biocatalysis

    • The membrane proliferation observed with YibN overproduction could be exploited to enhance vesicle production

  • Biosensor development:

    • YidC-mediated insertion of sensing elements into synthetic membranes

    • Creation of stable membrane protein arrays for detection applications

    • Potential for improved stability and orientation control compared to conventional reconstitution methods

  • Synthetic biology applications:

    • Engineering artificial membrane systems with controlled composition and function

    • YidC as a component in minimal cell projects requiring membrane protein insertion

    • Development of membrane-based compartments for multi-enzyme reactions

  • Research tools for membrane protein studies:

    • YidC-based pull-down systems to identify interaction partners

    • Screening platforms for membrane protein inhibitors

    • Assay systems for membrane protein insertion efficiency

The combination of YidC with its recently identified partner YibN is particularly promising, as their co-expression significantly enhances membrane protein biogenesis. This natural enhancement system could be harnessed for improved production of difficult membrane protein targets in biotechnology and structural biology applications.

What emerging research directions might lead to transformative insights into YidC function in Burkholderia species over the next decade?

Several cutting-edge research directions hold promise for transformative insights into YidC function in Burkholderia species:

  • Systems-level integration of membrane protein biogenesis:

    • Comprehensive profiling of the membrane proteome under various conditions

    • Integration with transcriptomics and metabolomics to build predictive models

    • Network-based approaches to understand how YidC functions within larger cellular systems

    • Building on proteomic profiling approaches established for Burkholderia biofilms

  • Cryo-electron tomography of native membranes:

    • Visualizing YidC and its partners in their native membrane environment

    • Mapping the spatial organization of membrane insertion machinery in intact cells

    • Comparing organization between planktonic and biofilm states

    • Potentially revealing previously undetected higher-order complexes

  • Single-molecule studies of insertion mechanisms:

    • Real-time visualization of individual insertion events

    • Measuring forces and kinetics during membrane protein insertion

    • Determining how YidC and YibN collaborate at the molecular level

    • Understanding the energetics of YidC-mediated insertion

  • Synthetic biology approaches:

    • Minimal YidC systems with defined components

    • Engineering orthogonal insertion pathways for synthetic membrane proteins

    • Creating YidC variants with enhanced or altered substrate specificity

    • Building on discoveries of functional YidC-YibN enhancement

  • Evolutionary approaches to function:

    • Deep mutational scanning of YidC to map functional constraints

    • Ancestral sequence reconstruction to understand evolutionary trajectories

    • Comparative analysis across diverse Burkholderia species and strains

    • Building on evolutionary insights about SecY-YidC relationships

  • Lipid-protein interface studies:

    • Detailed mapping of how YidC interacts with specific lipids

    • Understanding the mechanistic basis of YidC's lipid scramblase activity

    • Investigating how YibN modulates this activity

    • Applying native mass spectrometry to identify specifically bound lipids

  • Dynamics and conformational changes:

    • Time-resolved structural studies of YidC during the insertion cycle

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Molecular dynamics simulations of the insertion process

    • Understanding how YidC's structure relates to its dual insertase/scramblase functions

  • Host-pathogen interface studies:

    • How YidC-dependent membrane proteins contribute to virulence

    • Role of YidC in adaptation to host environments

    • Potential YidC-dependent factors in antimicrobial resistance

    • Building on insights from proteomic studies of Burkholderia biofilms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.