Recombinant Burkholderia ambifaria Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Burkholderia ambifaria Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA)

Recombinant Burkholderia ambifaria monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a His-tagged, full-length enzyme (1–245 amino acids) expressed in E. coli. Its primary function involves catalyzing the glycosylation step in peptidoglycan biosynthesis, a critical process for bacterial cell wall assembly . The enzyme is encoded by the mtgA gene (UniProt ID: Q0BIE9 or B1YSX5, depending on strain), with homologs identified in Burkholderia species .

Expression and Purification

mtgA is produced via recombinant expression in E. coli, with purification optimized for high yield and stability. Key parameters include:

ParameterDetails
Purity>90% (SDS-PAGE-verified)
Storage BufferTris/PBS-based or Tris-based buffer with 6% trehalose and 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability
LyophilizationFreeze-dried powder (avoid repeated freeze-thaw cycles)

Role in Peptidoglycan Biosynthesis

mtgA catalyzes the transfer of peptidoglycan units to growing glycan chains, a monofunctional activity distinct from bifunctional penicillin-binding proteins (PBPs). This specificity makes it a target for studying:

  • Antibiotic resistance mechanisms: β-lactams (e.g., penicillins) inhibit PBPs but not mtgA, suggesting potential roles in resistance .

  • Bacterial cell wall dynamics: mtgA’s activity is critical for maintaining structural integrity during growth and division.

Strain-Specific Variations

Sequence discrepancies (e.g., Q0BIE9 vs. B1YSX5) highlight potential functional differences between Burkholderia ambifaria strains. Researchers should verify UniProt IDs and strain origins .

Stability and Handling

  • Storage: -20°C/-80°C recommended; avoid repeated freeze-thaw cycles.

  • Reconstitution: Use sterile water or buffer to prevent aggregation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mtgA; BamMC406_0539; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
mtgA
Target Protein Sequence
MAAVSGTRRTRAVSPTRWIVYAGSVFAGAWLATQLFYLVQIALWSFINPGSTAFMRTDAW WLSRDKPPAQVQHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGR IVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETVLDKERIFEIYLNSVEWGRGV YGAEAAARYYYRIPASRLGAWQSARLAVMLPKPRWFDAHRGSAYQAQRAAVIARRMGAAE LPQSQ
Uniprot No.

Target Background

Function
Peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does mtgA localize within bacterial cells and interact with other cell division proteins?

Based on studies in Escherichia coli, MtgA localizes at the division site of cells, particularly in strains deficient in PBP1b that produce a thermosensitive PBP1a . The protein interacts with three constituents of the divisome: PBP3, FtsW, and FtsN . These interactions suggest that mtgA plays a collaborative role in peptidoglycan assembly during cell division.

Bacterial two-hybrid system experiments with E. coli demonstrated that MtgA interacts specifically in vivo with PBP3, FtsW, and FtsN, and that the transmembrane segment of PBP3 is required for this interaction . Additionally, MtgA can interact with itself, suggesting potential dimerization or oligomerization during function .

The level of β-galactosidase activity resulting from complementation by the Cya fusion pairs MtgA-PBP3, MtgA-FtsN, and MtgA-FtsW in permeabilized cells was at least 10-, 20-, and 37-fold higher, respectively, than controls (approximately 100 U/mg) . While these interactions were observed in E. coli, similar protein-protein interactions likely occur in Burkholderia species, given the conserved nature of cell division machinery.

What is the role of mtgA in Burkholderia ambifaria phase variation and virulence?

Recent research has revealed that B. ambifaria undergoes phase variation, a mechanism by which bacteria reversibly switch between phenotypic states. Unlike some other Burkholderia cepacia complex (Bcc) species that lose the pC3 virulence megaplasmid during adaptation, B. ambifaria can exhibit phase variation while retaining pC3 .

Two key systems regulate phase variation in B. ambifaria:

  • The Cep quorum-sensing (QS) system promotes the emergence of variants

  • DNA methylation, particularly via an orphan type II DNA methyltransferase, inhibits variant emergence

While direct evidence linking mtgA to phase variation is limited, peptidoglycan synthesis enzymes like mtgA might be affected by or contribute to these regulatory systems. The interplay between quorum sensing, DNA methylation, and cell wall metabolism could influence bacterial adaptation to different environments, including host tissues during infection.

B. ambifaria is part of the Burkholderia cepacia complex, which includes opportunistic pathogens that can cause serious respiratory infections in cystic fibrosis patients and immunocompromised individuals . Understanding mtgA's contribution to cell wall structure and potential role in adaptation could provide insights into B. ambifaria pathogenesis.

How can researchers assess the enzymatic activity of recombinant mtgA in vitro?

Researchers can assess the transglycosylase activity of recombinant mtgA through several established methods:

Lipid II polymerization assay:
This method measures the incorporation of radiolabeled precursors into peptidoglycan strands. For example, with GFP-MtgA fusion proteins, researchers observed a 2.4-fold increase in peptidoglycan polymerization compared to controls (26% versus 11% of lipid II used) . The reaction typically contains:

  • Radiolabeled lipid II substrate (e.g., 9,180 dpm/nmol)

  • Buffer components (50 mM HEPES, pH 7.0)

  • Co-solvents (15% dimethyl sulfoxide, 10% octanol)

  • Detergent (0.5% decyl-polyethylene glycol)

  • Divalent cation (10 mM CaCl₂)

Membrane-based assays:
Using bacterial membrane fractions (e.g., from Aerococcus viridans) supplemented with:

  • [¹⁴C]UDP-N-acetylglucosamine (specific activity ~4,000 cpm/nmol)

  • UDP-N-acetylmuramylpentapeptide

  • MgCl₂ (50 mM)

  • KCl (0.21 mM)

  • NH₄Cl (0.83 mM)

  • Penicillin G (250 μg/ml, to inhibit transpeptidase activity)

  • Buffer (50 mM Tris-HCl, 50 mM PIPES)

The products can be separated by chromatography and analyzed for peptidoglycan formation. Complete digestion by lysozyme confirms the nature of the polymerized material .

What approaches can be used to study the role of mtgA in antibiotic resistance mechanisms?

Burkholderia species exhibit various mechanisms of antibiotic resistance, including those targeting cell wall synthesis. Several approaches can be used to investigate mtgA's potential role:

Gene knockout studies:
Creating mtgA deletion mutants can reveal its contribution to cell wall integrity and antibiotic susceptibility. Similar studies with other monofunctional transglycosylases have shown that:

  • In Staphylococcus aureus, monofunctional transglycosylases (MGT and SgtA) are not individually essential, but MGT becomes essential in the absence of PBP2 transglycosylase activity

  • These enzymes may function within larger cell wall-synthetic complexes

β-lactam challenge experiments:
Exposing wild-type and mtgA-modified strains to β-lactam antibiotics can reveal changes in:

  • Minimum inhibitory concentrations (MICs)

  • Cell morphology

  • Gene expression patterns

Biofilm formation assays:
Since cell wall structure affects biofilm formation, which contributes to antibiotic tolerance, researchers can assess how mtgA modifications alter:

  • Biofilm matrix components

  • Biofilm architecture

  • Antibiotic susceptibility in biofilm versus planktonic cells

Burkholderia species often show resistance to β-lactams through various mechanisms. In B. ubonensis, intrinsic resistance to carbapenems is mediated by an inducible class A β-lactamase . While mtgA itself is not a β-lactamase, alterations in cell wall synthesis pathways can affect sensitivity to cell wall-targeting antibiotics.

What are the optimal conditions for expressing and purifying recombinant B. ambifaria mtgA?

Based on available commercial preparations and standard recombinant protein methods, the following conditions are recommended:

Expression system:

  • Host: E. coli

  • Vector: pET-based expression system with N-terminal His-tag

  • Induction: IPTG-inducible promoter

Purification protocol:

  • Affinity chromatography using Ni-NTA resin

  • Buffer exchange to remove imidazole

  • Optional ion exchange chromatography for higher purity

  • Final storage in Tris/PBS-based buffer, pH 8.0, with 6% trehalose for stability

Storage conditions:

  • Store at -20°C/-80°C upon receipt

  • Add glycerol (final concentration 50%) for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution:
Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can researchers design experiments to investigate mtgA's interaction with quorum sensing systems?

The interplay between peptidoglycan synthesis and quorum sensing (QS) systems in Burkholderia species represents an important area of research. Based on studies showing that quorum sensing regulates phase variation in B. ambifaria , researchers can design experiments to explore mtgA's potential involvement:

1. Gene expression analysis:

  • RT-qPCR to measure mtgA expression levels in response to QS signal molecules

  • RNA-seq to identify co-regulated genes in the mtgA and QS pathways

  • Reporter gene fusions (e.g., mtgA promoter-lacZ) to monitor expression changes

2. Protein-protein interaction studies:

  • Bacterial two-hybrid system (as used successfully with E. coli MtgA)

  • Co-immunoprecipitation with QS regulators

  • Pull-down assays with recombinant proteins

3. Phenotypic impact of QS inhibition:
In B. cenocepacia, the unsaturated fatty acid compound cis-14-methylpentadec-2-enoic acid (14-Me-C16:Δ2) interferes with QS signaling . Researchers can test how such QS inhibitors affect:

  • mtgA expression

  • Peptidoglycan structure

  • Cell wall integrity

  • Antibiotic susceptibility

4. c-di-GMP signaling connection:
Studies have shown that:

  • Disruption of QS systems affects intracellular c-di-GMP levels in B. cenocepacia

  • c-di-GMP signaling influences biofilm formation and motility in Burkholderia species

  • Phosphodiesterases and diguanylate cyclases involved in c-di-GMP cycling affect root colonization in Burkholderia vietnamiensis

Experiments could investigate whether mtgA activity or expression is modulated by c-di-GMP levels, potentially connecting cell wall synthesis to broader bacterial adaptation mechanisms.

What methods can be used to assess the role of mtgA in bacterial cell division and morphology?

To investigate mtgA's role in cell division and morphology, researchers can employ several complementary approaches:

Microscopy techniques:

  • Fluorescence microscopy with GFP-mtgA fusions to track subcellular localization during different growth phases

  • Time-lapse microscopy to observe potential division defects in mtgA mutants

  • Electron microscopy to examine peptidoglycan structure and cell wall thickness

Genetic approaches:

  • Generation of conditional mtgA mutants using inducible promoters

  • Complementation studies with wild-type and mutated forms of mtgA

  • Suppressor screens to identify genetic interactions

Cell division protein interactions:
Building on findings from E. coli studies , researchers can investigate mtgA's interactions with divisome components in Burkholderia using:

  • Bacterial two-hybrid system with B. ambifaria proteins

  • Co-localization studies with fluorescently tagged proteins

  • In vitro reconstitution of peptidoglycan synthesis complexes

Peptidoglycan analysis:

  • Isolation and chemical analysis of peptidoglycan from wild-type and mtgA-modified strains

  • Muropeptide profiling by HPLC

  • Assessment of glycan chain length distribution

How might mtgA serve as a potential target for novel antimicrobial strategies against Burkholderia species?

Given the essential nature of peptidoglycan synthesis for bacterial viability, mtgA represents a potential target for novel antimicrobial strategies against Burkholderia species, which are often resistant to multiple antibiotics.

Potential approaches include:

1. Direct enzyme inhibition:

  • Developing small molecules that specifically target the transglycosylase active site

  • Designing peptidoglycan mimetics that compete with natural substrates

  • Exploring natural products with activity against transglycosylases

2. Disruption of protein-protein interactions:

  • Targeting mtgA's interactions with divisome components

  • Interfering with potential dimerization or complex formation

3. Combination therapies:

  • Exploiting synergistic effects between mtgA inhibitors and:

    • β-lactam antibiotics

    • Quorum sensing inhibitors like 14-Me-C16:Δ2

    • Other cell wall-active agents

4. Biofilm disruption strategies:

  • Since cell wall synthesis affects biofilm formation, mtgA inhibitors might reduce biofilm-associated antibiotic tolerance

  • Combined approaches targeting both planktonic and biofilm bacteria

The therapeutic potential is particularly relevant for Burkholderia cepacia complex infections in cystic fibrosis patients, where antibiotic resistance and biofilm formation contribute to treatment challenges .

What is the relationship between mtgA function and bacterial adaptation to environmental stresses?

Bacterial cell wall remodeling plays a crucial role in adaptation to environmental stresses. Future research could explore how mtgA contributes to B. ambifaria's ability to adapt to different environments:

Stress conditions to investigate:

  • Osmotic stress (affecting cell wall integrity)

  • Antibiotic exposure (particularly cell wall-targeting agents)

  • Host-derived antimicrobial peptides

  • Oxidative stress during host-pathogen interactions

  • Nutrient limitation

Potential research questions:

  • Does mtgA expression or activity change in response to stress?

  • How does peptidoglycan structure differ in stressed versus unstressed conditions?

  • Are mtgA mutants more susceptible to specific environmental stresses?

  • Does the interplay between quorum sensing, DNA methylation, and mtgA function contribute to stress adaptation?

Understanding these relationships could provide insights into Burkholderia's remarkable adaptability across diverse ecological niches, from soil and plant roots to human respiratory tracts .

How does mtgA in B. ambifaria compare with homologous enzymes in other bacterial species?

Comparative studies of mtgA across bacterial species could reveal evolutionary adaptations and functional divergence:

Phylogenetic analysis:

  • Sequence comparison of mtgA proteins from diverse bacteria

  • Identification of conserved domains and species-specific variations

  • Evolutionary history of monofunctional transglycosylases

Functional comparison:

  • Enzymatic properties (substrate specificity, reaction kinetics)

  • Protein-protein interactions

  • Regulation mechanisms

  • Essentiality across species

Table: Comparison of mtgA characteristics across selected bacterial species

SpeciesProtein LengthKey Structural FeaturesCellular LocalizationEssential for ViabilityKnown Interactions
B. ambifaria245 aaN-terminal transmembrane domainPresumed at division siteUnknownUnknown
E. coliSimilar lengthTransmembrane domainDivision siteNoPBP3, FtsW, FtsN
S. aureus253 aaN-terminal His-tag fusionCell membraneNo (unless PBP2 TGase inactive) PBP2, cell wall synthesis enzymes

These comparative studies could inform both basic understanding of bacterial cell wall synthesis mechanisms and applied research into species-specific antibacterial strategies.

What quality control measures should be implemented when working with recombinant B. ambifaria mtgA?

To ensure experimental reproducibility and reliable results, researchers should implement the following quality control measures:

Protein purity assessment:

  • SDS-PAGE analysis (>90% purity recommended)

  • Mass spectrometry to confirm protein identity

  • Absence of contaminating E. coli proteins or endotoxins

Functional validation:

  • In vitro transglycosylase activity assay

  • Confirmation of expected molecular weight (approximately 27 kDa plus tag)

  • Proper folding assessment via circular dichroism or thermal shift assays

Storage and handling:

  • Avoid repeated freeze-thaw cycles

  • Monitor protein stability over time

  • Consider adding glycerol or trehalose as stabilizing agents

Lot-to-lot consistency:

  • Maintain detailed records of expression and purification conditions

  • Establish reference standards for activity comparisons

  • Document any variations in sequence or post-translational modifications

These measures are particularly important when investigating subtle phenotypic effects or when comparing results across different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.