Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit A (nuoA)

What is the molecular structure of Burkholderia ambifaria NADH-quinone oxidoreductase subunit A?

Burkholderia ambifaria nuoA is a small membrane protein consisting of 119 amino acids with a molecular weight of approximately 13 kDa. The full amino acid sequence is: MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE . This hydrophobic protein contains multiple transmembrane helices that anchor it in the bacterial inner membrane. As part of Complex I (NADH:ubiquinone oxidoreductase), nuoA is one of the smallest subunits and is located in the membrane domain of the complex. The protein contains specific conserved residues that are crucial for proper assembly and function of the respiratory complex.

What is the genomic organization of the nuoA gene in the Burkholderia ambifaria genome?

The nuoA gene in Burkholderia ambifaria is part of the nuo operon, which contains 14 structural genes (nuoA to nuoN) that collectively encode the subunits of Complex I . In B. ambifaria strain MC40-6, the nuoA gene is identified by the ordered locus name BamMC406_2166 . The gene is positioned at the start of the nuo operon, with nuoA being the first structural gene in the operon after the promoter region. The organization of the nuo genes corresponds to the assembly of three functional modules of Complex I: the NADH dehydrogenase fragment (NDF), the connecting fragment, and the membrane fragment. Transcriptional analysis using RNA hybridization confirms that these genes are co-transcribed as a polycistronic mRNA from a common promoter (nuoP), with insertional mutations in any nuo gene typically preventing expression of downstream genes due to polar effects .

What are the optimal methods for expressing recombinant Burkholderia ambifaria nuoA?

The optimal expression system for recombinant B. ambifaria nuoA is E. coli with an N-terminal His-tag to facilitate purification . For successful expression, consider these methodological approaches:

• Vector selection: pET series vectors with T7 promoter systems are preferred for controlled, high-level expression. The strong promoter can be regulated by IPTG induction.

• Host strain selection: E. coli strains BL21(DE3) or C41(DE3) are recommended, with the latter being specialized for membrane protein expression .

• Expression conditions:

  • Induction at OD600 of 0.6-0.8

  • Lower temperature induction (16-18°C) for 16-20 hours to enhance proper folding

  • IPTG concentration of 0.1-0.5 mM to avoid formation of inclusion bodies

  • Supplementation with 1% glucose to reduce basal expression

• Membrane protein considerations: As nuoA is a membrane protein, addition of mild detergents (0.1% DDM or 0.5% CHAPS) to lysis buffers is essential for solubilization.

The expression of full-length nuoA with proper folding is challenging due to its hydrophobic nature and multiple transmembrane domains. Co-expression with chaperones (GroEL/GroES) has been shown to improve the yield of properly folded membrane proteins.

What purification strategies yield highest purity and activity for recombinant nuoA?

For optimal purification of recombinant His-tagged nuoA from B. ambifaria, a multi-step purification strategy is recommended:

• Membrane fraction isolation:

  • Cell disruption by sonication or French press in buffer containing protease inhibitors

  • Differential centrifugation (10,000 × g to remove cell debris, followed by 100,000 × g to collect membrane fraction)

  • Membrane solubilization using detergents (typically 1% DDM or 1% Triton X-100)

• Immobilized metal affinity chromatography (IMAC):

  • Ni-NTA resin for His-tagged protein binding

  • Gradual imidazole gradient (20-250 mM) for elution

  • Buffer containing 0.1% detergent to maintain solubility

• Size exclusion chromatography:

  • For removal of aggregates and further purification

  • Superdex 75 or 200 columns are suitable

• Storage conditions:

  • Tris-based buffer with 50% glycerol at -20°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

The purified protein can be verified by SDS-PAGE, Western blotting using anti-His antibodies, and mass spectrometry to confirm identity and integrity.

How can researchers assess the functional integrity of purified recombinant nuoA?

Assessing the functional integrity of purified recombinant nuoA requires several complementary approaches:

• Complex I reconstitution assays:

  • Incorporation of purified nuoA with other Complex I subunits

  • Measurement of NADH:ubiquinone oxidoreductase activity in the reconstituted complex

  • Comparison with activity from wild-type Complex I

• Membrane incorporation:

  • Reconstitution into liposomes or nanodiscs

  • Assessment of proper membrane insertion via protease protection assays

• Protein-protein interaction studies:

  • Pull-down assays with other Complex I subunits

  • Crosslinking studies to verify native-like interactions

• Spectroscopic methods:

  • Circular dichroism (CD) to assess secondary structure content

  • Electron paramagnetic resonance (EPR) spectroscopy to detect proper association with iron-sulfur clusters when in complex with other subunits

• Complementation studies:

  • Transformation of nuoA-deficient bacterial mutants with recombinant nuoA

  • Assessment of growth phenotype restoration and Complex I activity

When evaluating the functionality of recombinant nuoA, it's important to note that the isolated subunit alone may not exhibit enzymatic activity, as its function depends on proper assembly with other Complex I subunits. Therefore, complementation studies in nuoA-deficient strains provide the most direct evidence of functional integrity.

How do mutations in nuoA affect Complex I assembly and function?

Mutations in the nuoA gene have profound effects on Complex I assembly and function, providing valuable insights into structure-function relationships:

• Complete deletion mutations:

  • The ΔnuoG1 deletion mutation results in complete loss of Complex I activity

  • EPR spectroscopy analysis shows no detectable amounts of Complex I or subcomplexes in membrane fractions of nuoA mutants

  • Absence of tetranuclear N2, N3, and N4 iron-sulfur clusters in membranes of mutants

• Insertional mutations:

  • Affect expression of downstream genes through polar effects, as demonstrated by RNA hybridization experiments

  • Lead to the Nuo- phenotype characterized by:

    • Growth defects in complex media

    • Inability to form the inner aspartate ring in swarm assays

    • Impaired utilization of certain carbon sources

• Point mutations in conserved residues:

  • Can disrupt protein-protein interactions within the complex

  • May affect membrane insertion and proper folding

  • Can alter proton translocation efficiency without completely abolishing assembly

• Complementation analysis:

  • In cis complementation with the wild-type nuoA gene restores Complex I function

  • This indicates that the phenotypes observed are specifically due to nuoA disruption rather than polar effects on other genes

These mutational studies have established that nuoA is essential for proper Complex I assembly and function, despite not directly participating in electron transfer or containing redox cofactors.

What techniques are most effective for studying nuoA interactions with other Complex I subunits?

Several advanced techniques can effectively elucidate nuoA interactions with other Complex I subunits:

• Crosslinking coupled with mass spectrometry (XL-MS):

  • Chemical crosslinkers (e.g., DSS, BS3) stabilize transient interactions

  • Mass spectrometry identifies crosslinked peptides

  • Provides spatial constraints for protein-protein interfaces

• Co-immunoprecipitation (Co-IP):

  • Using anti-nuoA antibodies or antibodies against the His-tag

  • Coupled with western blotting or mass spectrometry to identify interaction partners

  • Can be performed under various conditions to assess interaction strength

• Bacterial two-hybrid (B2H) system:

  • Allows mapping of specific interaction domains

  • Can screen libraries for interaction partners

  • Useful for identifying critical residues at interaction interfaces

• Förster resonance energy transfer (FRET):

  • Requires fluorescently labeled subunits

  • Provides information about proximity (typically <10 nm) between subunits

  • Can be performed in living cells to capture dynamic interactions

• Cryo-electron microscopy:

  • Provides structural information at near-atomic resolution

  • Can visualize the position of nuoA within the complex

  • Differences in structures with wild-type versus mutant nuoA can reveal functional insights

• Native gel electrophoresis:

  • Blue native PAGE to analyze intact Complex I

  • Can detect subcomplexes formed in the absence of certain subunits

  • Western blotting with subunit-specific antibodies identifies composition

How does nuoA from Burkholderia ambifaria compare to homologous proteins in other bacterial species?

Comparative analysis of nuoA across bacterial species reveals important evolutionary and functional insights:

• Sequence conservation:

  • The 119-amino acid length of B. ambifaria nuoA is highly conserved among related species

  • Transmembrane domains show higher conservation than loop regions

  • Key interface residues that interact with other subunits are most conserved

• Taxonomic distribution:

  • NuoA is present in most bacteria with aerobic metabolism

  • Absent in some obligate anaerobes that lack Complex I

  • Some bacteria have alternative electron transport complexes (Ndh-2) instead of the nuo system

• Species-specific variations:

  • B. ambifaria nuoA shows closest homology to other members of the Burkholderia cepacia complex

  • More distant homology to nuoA from other proteobacteria like E. coli

  • These variations correlate with taxonomic relationships established through polyphasic taxonomic studies

• Functional conservation vs. adaptation:

• Evolutionary implications:

  • The high conservation suggests strong selective pressure on nuoA structure and function

  • Differences may reflect adaptation to specific environmental niches

  • The polyphasic taxonomic study of B. ambifaria revealed it as a distinct species within the B. cepacia complex, with unique genomic features that would affect the structure and function of proteins like nuoA

Understanding these comparative aspects helps researchers interpret experimental results across different bacterial models and assess the broader implications of findings in B. ambifaria.

What role might nuoA play in the pathogenicity of Burkholderia ambifaria in cystic fibrosis patients?

The potential role of nuoA in B. ambifaria pathogenicity is a complex and important research question, particularly regarding cystic fibrosis (CF) patients:

• Energy metabolism during infection:

  • As part of Complex I, nuoA contributes to energy production via respiration

  • Efficient energy metabolism is essential for bacterial survival in the host environment

  • Disruption of nuoA function leads to growth defects , which could impair virulence

• Adaptation to the CF lung environment:

  • The CF lung presents a unique microenvironment with altered oxygen availability

  • Complex I function may be particularly important under the microaerobic conditions found in CF lung mucus

  • B. ambifaria strains isolated from CF patients may show adaptations in respiratory components

• Potential virulence considerations:

  • B. ambifaria was isolated from both environmental sources and CF patients

  • The finding that this species includes both strains from CF patients and potentially useful biocontrol strains raises concerns about pathogenic potential

  • The consensus in the scientific community is that large-scale use of biocontrol strains belonging to the B. cepacia complex would be ill-advised until more is known about pathogenic mechanisms

• Research implications:

  • Studying nuoA mutants in infection models could reveal its importance in virulence

  • Comparing nuoA sequence and expression between clinical and environmental isolates may identify adaptations

  • Understanding nuoA's role in metabolism during infection could inform therapeutic strategies

• Therapeutic target potential:

  • If nuoA proves essential for virulence, it could represent a novel therapeutic target

  • Inhibitors targeting bacterial respiratory complexes could be developed

  • The differences between bacterial and human respiratory complexes offer selective targeting opportunities

Research on this topic requires careful experimental design with appropriate biosafety considerations given the opportunistic pathogen status of B. ambifaria in CF patients.

What methods can be used to measure electron transport activity involving nuoA in Complex I?

Measuring electron transport activity involving nuoA in Complex I requires specialized techniques:

• NADH:ubiquinone oxidoreductase activity assays:

  • Spectrophotometric monitoring of NADH oxidation at 340 nm

  • NADH oxidation coupled to reduction of artificial electron acceptors (e.g., ferricyanide)

  • Specific inhibitors (e.g., rotenone, piericidin A) can confirm Complex I involvement

  • Comparison between wild-type and nuoA mutant strains provides functional insights

• Oxygen consumption measurements:

  • Clark-type oxygen electrodes measure respiratory rates

  • Addition of specific substrates and inhibitors isolates Complex I contribution

  • Membrane vesicles can be used to study isolated respiratory components

• Proton translocation assays:

  • pH-sensitive fluorescent dyes (e.g., ACMA, pyranine) detect proton movement

  • Reconstituted proteoliposomes containing purified Complex I

  • Measurement of membrane potential using potentiometric dyes (e.g., DiSC3(5))

• EPR spectroscopy:

  • Detects iron-sulfur clusters in Complex I

  • Comparison between wild-type and nuoA mutants reveals effects on FeS center formation

  • Research has shown that EPR analysis detected no iron-sulfur clusters (N2, N3, and N4) in membrane fractions of any nuo mutants tested

• Membrane fragment analysis:

  • Blue native PAGE separates intact respiratory complexes

  • Activity staining with NADH and electron acceptors (e.g., NBT)

  • In-gel activity assays can localize Complex I function

These methods collectively provide comprehensive assessment of how nuoA contributes to electron transport chain function, particularly when comparing wild-type systems to those with modified or absent nuoA.

How can researchers create and characterize nuoA mutants for functional studies?

Creating and characterizing nuoA mutants involves several sophisticated methodological approaches:

• Generation of nuoA mutants:

  • Deletion mutants: Can be created using homologous recombination approaches as demonstrated with ΔnuoG1 constructs

  • Insertional inactivation: Using transposons (Tn10, miniTn10Cm) or antibiotic resistance cassettes (Km)

  • Point mutations: Site-directed mutagenesis targeting conserved residues

  • Domain swapping: Replacing regions with corresponding segments from other species

• Genetic verification techniques:

  • PCR verification of mutations using primers flanking the targeted region

  • Whole-cell PCR for screening recombinants

  • DNA sequencing to confirm the exact genetic changes

  • Southern blotting to verify chromosomal integration

• Transcriptional analysis:

  • RNA extraction and purification from both wild-type and mutant strains

  • Northern blotting with specific probes to detect transcripts

  • RT-PCR to analyze expression of nuoA and downstream genes

  • Reporter gene fusions (e.g., nuoPA::lacZYA) to measure promoter activity

• Phenotypic characterization:

  • Growth assays: Testing growth in different media and carbon sources

  • Swarm assays: Examining formation of inner aspartate ring on swarm plates

  • Carbon source utilization: Testing ability to use acetate as sole carbon source

  • Biochemical assays: Measuring NADH dehydrogenase activity with various substrates

• Complementation studies:

  • In trans complementation by introducing wild-type nuoA on plasmids

  • In cis complementation through chromosomal integration

  • Testing restoration of wild-type phenotype and Complex I activity

What computational methods can predict nuoA structure and interactions?

Advanced computational methods offer valuable insights into nuoA structure and interactions:

• Protein structure prediction:

  • Homology modeling: Using resolved structures of homologous proteins as templates

  • Ab initio modeling: For regions with no homologous templates

  • AlphaFold2/RoseTTAFold: Deep learning approaches that have revolutionized membrane protein structure prediction

  • Refinement with molecular dynamics: To optimize structures in membrane environments

• Transmembrane topology prediction:

  • TMHMM/HMMTOP: Hidden Markov Models for transmembrane helix prediction

  • MEMSAT: Neural network-based topology prediction

  • TOPCONS: Consensus approach integrating multiple predictors

  • Based on the amino acid sequence (MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE), nuoA is predicted to contain multiple transmembrane helices

• Protein-protein interaction prediction:

  • Molecular docking: Predicting binding modes between nuoA and other Complex I subunits

  • Coevolution analysis: Identifying co-evolving residues likely to be at interaction interfaces

  • Protein-protein interaction databases: Mining existing data for known interactions

  • Machine learning approaches: Training on known respiratory complex structures

• Molecular dynamics simulations:

  • All-atom simulations: Detailed analysis of nuoA behavior in membrane environments

  • Coarse-grained simulations: For studying larger-scale dynamics and assembly

  • Free energy calculations: For quantifying interaction strengths

  • Proton translocation simulations: To understand functional mechanisms

• Evolutionary analysis:

  • Multiple sequence alignment: Identifying conserved functional residues across species

  • Phylogenetic analysis: Tracking nuoA evolution across bacterial lineages

  • Positive selection analysis: Detecting adaptively evolving sites

  • Ancestral sequence reconstruction: Understanding evolutionary trajectories

These computational approaches complement experimental studies by providing structural and mechanistic hypotheses that can guide experimental design and interpretation of results.

Could nuoA serve as a potential target for developing antimicrobials against Burkholderia ambifaria?

The potential of nuoA as an antimicrobial target requires careful consideration of several factors:

• Target suitability assessment:

  • Essentiality: Mutational studies confirm that disruption of nuoA results in growth defects and impaired energy metabolism

  • Conservation: NuoA is highly conserved within Burkholderia species but differs from human proteins

  • Accessibility: As a membrane protein, nuoA presents challenges for drug delivery

• Potential targeting strategies:

  • Small molecule inhibitors: Designed to disrupt nuoA assembly into Complex I

  • Peptide inhibitors: Mimicking interaction interfaces between nuoA and other subunits

  • Assembly inhibition: Compounds that prevent proper insertion of nuoA into the membrane

  • Allosteric modulators: Molecules that bind to nuoA and alter Complex I function

• Experimental approaches for drug discovery:

  • High-throughput screening: Using bacterial growth inhibition as a primary screen

  • Target-based screening: Assays specifically measuring Complex I activity

  • Fragment-based drug discovery: Building inhibitors from small molecular fragments

  • Structure-based drug design: Using computational models of nuoA

• Potential advantages as a target:

  • Targeting respiratory chains can be effective against metabolically active bacteria

  • Bacterial respiratory complexes differ significantly from mammalian equivalents

  • Inhibition of energy metabolism may potentiate other antimicrobials

• Considerations and challenges:

  • The presence of alternative respiratory pathways may limit efficacy

  • Membrane proteins are historically challenging drug targets

  • Burkholderia species are known for intrinsic resistance to many antibiotics

  • Safety concerns related to potential cross-reactivity with human respiratory complexes

The fact that B. ambifaria has been isolated from cystic fibrosis patients emphasizes the clinical relevance of developing novel antimicrobials against this opportunistic pathogen, particularly for this vulnerable patient population.

What can proteomic approaches reveal about post-translational modifications in nuoA?

Proteomic approaches offer powerful tools for investigating post-translational modifications (PTMs) in nuoA:

• Mass spectrometry-based identification of PTMs:

  • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS analysis

  • Top-down proteomics: Analysis of intact nuoA protein

  • Targeted approaches: Multiple reaction monitoring (MRM) for specific modifications

  • Enrichment strategies: Using antibodies or chemical approaches to isolate modified peptides

• Common PTMs to investigate in nuoA:

  • Phosphorylation: May regulate Complex I assembly or activity

  • Acetylation: Can affect protein-protein interactions

  • Oxidative modifications: May occur during respiratory activity

  • Lipid modifications: Could affect membrane insertion and stability

• Functional characterization of identified PTMs:

  • Site-directed mutagenesis: Converting modified residues to non-modifiable variants

  • Phosphomimetic mutations: Substituting with Asp/Glu to mimic phosphorylation

  • Activity assays: Measuring impact on Complex I function

  • Interaction studies: Assessing effects on protein-protein interactions

• Physiological regulation through PTMs:

  • Environmental response: How different growth conditions affect PTM patterns

  • Stress response: Modifications during oxidative or nutrient stress

  • Temporal dynamics: PTM changes during growth phases or infection

• Methodological considerations:

  • Membrane proteins like nuoA require specialized extraction protocols

  • Detergents must be compatible with downstream MS analysis

  • Low abundance of some PTMs necessitates enrichment strategies

  • Careful controls needed to distinguish genuine PTMs from artifacts

These approaches can reveal how B. ambifaria regulates Complex I function through modifications of nuoA, potentially identifying novel regulatory mechanisms that could be exploited for antimicrobial development or biotechnological applications.

How might environmental conditions affect nuoA expression and function in Burkholderia ambifaria?

The expression and function of nuoA in B. ambifaria likely respond to various environmental conditions, with important implications for bacterial adaptation:

• Oxygen availability effects:

  • Under aerobic conditions, Complex I expression is typically high

  • Microaerobic environments may alter the expression pattern of nuo genes

  • Anaerobic conditions might lead to downregulation as alternative respiratory pathways are favored

  • These adaptations are particularly relevant given B. ambifaria's isolation from diverse environments and CF patients

• Nutrient availability influences:

  • Carbon source affects respiratory chain composition and activity

  • Growth on non-fermentable carbon sources increases reliance on respiratory complexes

  • Nutrient limitation may trigger adaptive responses in energy metabolism genes

  • Research has shown that nuo mutants exhibit different growth patterns depending on the carbon source

• Experimental approaches to study environmental regulation:

  • Transcriptomics: RNA-seq or microarray analysis under different conditions

  • Reporter constructs: nuoA promoter fused to fluorescent proteins or lacZ

  • Proteomics: Quantifying nuoA protein levels in response to environmental changes

  • Chromatin immunoprecipitation: Identifying transcription factors binding to the nuo promoter

• Environmental adaptation considerations:

  • B. ambifaria occurs in both environmental and clinical settings

  • Adaptation to different niches may involve changes in respiratory metabolism

  • Environmental isolates with biocontrol properties may have distinct regulatory patterns

  • Clinical isolates might show adaptations for survival in the host environment

• Biotechnological implications:

  • Understanding environmental regulation could inform optimal conditions for recombinant production

  • Knowledge of nuoA regulation might contribute to development of biosensors

  • Engineering regulatory elements could enhance expression for research applications

These investigations would provide valuable insights into how B. ambifaria adapts its energy metabolism to diverse environments, with implications for both basic science and applied research in biocontrol and medicine.