Recombinant Burkholderia ambifaria Probable intracellular septation protein A (BamMC406_1828)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characterization

Gene Identification:

  • Locus: BamMC406_1828 (synonyms: ispZ, yciB) .

  • Genomic Position: Chromosome 1 (2085651–2086181 bp, direct strand) .

  • GC Content: 59.13% .

Protein Features:

PropertyValue
Amino Acid Length176 residues
Molecular Weight~20 kDa (calculated)
SequenceMKFLFDLFPIILFFAAFKVWGIFTATAVAIVAT...
TagN-terminal His tag
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C

Functional Role in Bacterial Physiology

BamMC406_1828 is annotated as a probable intracellular septation protein, suggesting involvement in:

  • Cell Division: Mediates septum formation during bacterial replication.

  • Membrane Dynamics: Contains transmembrane domains (residues 1–176), indicating interactions with lipid bilayers .

  • Conservation: Homologs exist in other Burkholderia species, including B. cepacia and B. multivorans .

Recombinant Production and Applications

Expression and Purification:

  • Vector: pET-based plasmid.

  • Induction: IPTG-driven expression in E. coli.

  • Buffer Composition: Tris/PBS with 6% trehalose (pH 8.0) for stability .

Research Applications:

ApplicationDescription
Structural StudiesUsed in crystallography or SPR to analyze membrane protein interactions .
Antibiotic DevelopmentPotential target for disrupting cell division in pathogenic Burkholderia spp. .
Diagnostic ToolsAntigen for antibody production in BCC detection assays .

Comparative Genomic Insights

  • Phylogenetic Context: BamMC406_1828 clusters with B. ambifaria strains in core genome analyses, showing 78–84% nucleic acid identity across BCC species .

  • Operon Association: Co-located with genes involved in cell wall synthesis and stress response .

Clinical and Environmental Relevance

  • Pathogenicity: B. ambifaria is an opportunistic pathogen in cystic fibrosis patients, though BamMC406_1828’s direct role in virulence remains unconfirmed .

  • Biocontrol Potential: Environmental B. ambifaria strains (e.g., CF3) exhibit antifungal activity, suggesting septation proteins may contribute to microbial competition .

Unresolved Questions and Future Directions

  • Mechanistic Role: Structural studies are needed to elucidate its interaction with septation machinery (e.g., FtsZ).

  • Therapeutic Targeting: Screening inhibitors against BamMC406_1828 could yield novel antibacterials for BCC infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag if feasible.
Synonyms
yciB; BamMC406_1828; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
BamMC406_1828
Target Protein Sequence
MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGVANLYVVHNYTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
Plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant BamMC406_1828 production?

Multiple expression systems can be employed for the recombinant production of BamMC406_1828, each with distinct advantages:

Expression SystemAdvantagesLimitations
E. coliHigh yield, rapid growth, cost-effectivePotential inclusion body formation, lack of post-translational modifications
YeastEukaryotic modifications, good for membrane proteinsLonger expression time, complex media requirements
BaculovirusHigh-level expression, post-translational modificationsMore expensive, technically demanding
Mammalian cellsNative-like folding and modificationsLowest yield, highest cost, complex protocols

For membrane proteins like BamMC406_1828, E. coli systems often require optimization to minimize inclusion body formation. Different expression vectors incorporating various origins of replication (pMB1 or p15A) and promoters (PT7, Plac, Ptrc, Ptac, or PBAD) can be used to modulate expression levels .

How should researchers design experiments to study BamMC406_1828 function?

When designing experiments to study BamMC406_1828 function, researchers should consider:

  • Expression system selection: Choose between E. coli, yeast, baculovirus, or mammalian cells based on experimental needs. For initial characterization, E. coli systems are often preferred due to simplicity and yield .

  • Vector design considerations:

    • Select appropriate promoter strength (PT7, Plac, PBAD)

    • Choose suitable replication origin (high-copy pMB1 vs. low-copy p15A)

    • Include appropriate tags for purification/detection (His, Avi, etc.)

  • Control experiments:

    • Empty vector controls to account for metabolic burden

    • Expression of known membrane proteins as positive controls

    • Non-membrane protein expression for comparison

  • Localization studies:

    • Subcellular fractionation

    • Fluorescent protein fusions

    • Immunolocalization with antibodies against tags

  • Functional assays:

    • Cell division phenotype analysis

    • Membrane integrity assessments

    • Protein-protein interaction studies

The experimental design should follow proper scientific methodology with appropriate controls, statistical analysis, and replication .

How does the choice of expression system impact recombinant BamMC406_1828 yield and solubility?

The expression system significantly impacts both yield and solubility of recombinant BamMC406_1828. Research on recombinant protein expression systems reveals several key considerations:

Impact of replication origin and promoter strength:

  • High-copy vectors (pMB1-derived, 500-700 copies/cell) produce higher initial protein levels but often lead to increased metabolic burden and potential aggregation

  • Low-copy vectors (p15A, ~10 copies/cell) may result in lower initial expression but often produce more soluble protein

Promoter selection effects:
Different promoters show varying expression patterns:

  • PBAD promoters require higher inducer concentrations (2 mM L-arabinose) but often show lower insoluble fraction formation

  • Lac-based promoters (including PT7, Ptrc, Ptac) typically require lower inducer concentrations (0.1 mM IPTG) but may produce more inclusion bodies

Growth rate and metabolic burden correlation:
Research has demonstrated an inverse relationship between growth rate and recombinant protein expression. Table below shows representative data from similar membrane protein expression:

Vector TypeRelative Growth RateRelative Protein YieldSoluble Fraction (%)
Empty strain1.00--
pMB1 origin (high-copy)0.65100%45-55%
p15A origin (low-copy)0.7870-80%60-70%

The metabolic burden associated with transcription and translation of foreign genes involves a decrease in recombinant protein expression . For membrane proteins like BamMC406_1828, this effect is often pronounced due to additional burdens on the membrane insertion machinery.

What methodological approaches should be used to troubleshoot inclusion body formation with BamMC406_1828?

Inclusion body formation is a common challenge when expressing membrane proteins like BamMC406_1828. Research indicates several effective troubleshooting approaches:

  • Optimize expression conditions:

    • Reduce growth temperature (18-25°C instead of 37°C)

    • Decrease inducer concentration (0.01-0.05 mM IPTG instead of 0.1-1 mM)

    • Use defined medium instead of rich medium

    • Implement slower induction protocols (auto-induction or gradient induction)

  • Modify vector design:

    • Switch to low-copy vectors (p15A origin) to reduce expression rate

    • Test weaker promoters (PBAD instead of PT7)

    • Add solubility-enhancing fusion partners (MBP, SUMO, Thioredoxin)

  • Co-express chaperones and folding modulators:

    • GroEL/GroES system

    • DnaK/DnaJ/GrpE system

    • Specialized membrane protein chaperones

  • Optimize lysis and purification:

    • Use mild detergents appropriate for membrane proteins

    • Implement step-wise solubilization protocols

    • Test various buffer compositions

How can researchers design experiments to investigate BamMC406_1828's role in bacterial cell division?

Investigating BamMC406_1828's role in bacterial cell division requires a multi-faceted experimental approach:

  • Genetic manipulation studies:

    • Generate knockout/knockdown strains using CRISPR-Cas9 or homologous recombination

    • Create conditional expression systems (temperature-sensitive or inducible)

    • Develop point mutations in conserved domains

    • Implement complementation studies with wild-type and mutant variants

  • Microscopy-based analysis:

    • Phase contrast microscopy to assess cell morphology changes

    • Fluorescence microscopy with membrane dyes

    • Time-lapse imaging to observe division dynamics

    • Super-resolution techniques (STED, PALM, STORM) for detailed localization

  • Biochemical interaction studies:

    • Co-immunoprecipitation with known division proteins

    • Bacterial two-hybrid or split-GFP assays

    • Chemical crosslinking followed by mass spectrometry

    • Surface plasmon resonance or isothermal titration calorimetry

  • Structural studies:

    • Crystallography or cryo-EM (challenging for membrane proteins)

    • NMR for specific domains

    • In silico structural prediction and modeling

  • Cell division phenotype assessment:

    • Growth curve analysis under various conditions

    • Microscopy for cell size/shape analysis

    • Flow cytometry for DNA content

    • Specific staining of division septa

Since BamMC406_1828 is characterized as a probable intracellular septation protein, researchers should focus on its potential interactions with the divisome complex and its temporal and spatial regulation during the cell cycle .

What analytical techniques are most appropriate for studying the structure-function relationship of BamMC406_1828?

Studying the structure-function relationship of membrane proteins like BamMC406_1828 requires specialized analytical techniques:

  • Structural characterization methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • Nuclear magnetic resonance (NMR) for specific domains

    • Circular dichroism (CD) for secondary structure analysis

    • Fourier-transform infrared spectroscopy (FTIR)

    • Small-angle X-ray scattering (SAXS)

    • Computational structure prediction (AlphaFold2 predictions are available)

  • Functional assays coupled with structural data:

    • Site-directed mutagenesis targeting specific structural elements

    • Cysteine scanning mutagenesis

    • Domain swap experiments

    • Truncation analysis

  • Membrane interaction studies:

    • Lipid binding assays

    • Fluorescence resonance energy transfer (FRET)

    • Atomic force microscopy

    • Model membrane systems (nanodiscs, liposomes)

  • Dynamics assessment:

    • Hydrogen-deuterium exchange mass spectrometry

    • Molecular dynamics simulations

    • NMR relaxation measurements

    • FRET-based conformational sensors

When designing these experiments, researchers should consider the membrane environment crucial for proper folding and function. Using appropriate detergents or lipid environments during purification and analysis is essential for obtaining physiologically relevant results .

How can researchers design experiments to minimize metabolic burden when expressing BamMC406_1828?

Minimizing metabolic burden is crucial for optimal expression of membrane proteins like BamMC406_1828. Research suggests several strategies:

  • Vector and promoter optimization:

    • Balance copy number and promoter strength

    • Use low-copy vectors (p15A, ~10 copies/cell) with moderate-strength promoters

    • Implement tightly regulated inducible systems (PBAD)

    • Consider autoinduction methods for gradual expression

  • Growth condition optimization:

    • Reduce culture temperature (18-25°C)

    • Optimize media composition (carbon source type and concentration)

    • Consider alternative carbon sources (glycerol instead of glucose)

    • Implement fed-batch cultivation to control growth rate

  • Host strain selection:

    • Use strains with enhanced membrane protein expression capabilities

    • Consider strains with reduced proteolytic activity

    • Evaluate metabolically engineered strains

  • Metabolic engineering approaches:

    • Co-express chaperones and folding factors

    • Optimize codon usage for reduced translational burden

    • Modify central carbon metabolism genes

    • Balance cellular resources through integrated approaches

Research has demonstrated that growth rates can decrease by up to 35% when expressing membrane proteins with high-copy vectors, indicating significant metabolic burden. Studies show that optimizing the balance between replication origin and promoter strength can lead to 2-3 fold improvements in soluble protein yield .

What approaches can be used to validate the cellular localization and topology of BamMC406_1828?

Validating the cellular localization and topology of BamMC406_1828 requires multiple complementary approaches:

  • Subcellular fractionation techniques:

    • Differential centrifugation to separate membrane fractions

    • Sucrose gradient ultracentrifugation

    • Detergent-based membrane protein extraction

    • Analysis by Western blotting with tag-specific antibodies

  • Fluorescence microscopy approaches:

    • Fluorescent protein fusions (C-terminal and N-terminal)

    • Split-GFP complementation assays

    • Immunofluorescence with tag-specific antibodies

    • Co-localization with known membrane markers

  • Topology mapping methods:

    • Protease accessibility assays

    • Cysteine labeling of accessible residues

    • Reporter fusion analysis (PhoA/LacZ dual reporters)

    • Glycosylation mapping in eukaryotic systems

  • Biophysical approaches:

    • Atomic force microscopy

    • Electron microscopy with immunogold labeling

    • Super-resolution microscopy techniques

  • Computational prediction validation:

    • Experimental testing of predicted transmembrane domains

    • Analysis of charge distribution and hydrophobicity

    • Evolutionary conservation assessment

The amino acid sequence of BamMC406_1828 suggests multiple membrane-spanning regions, with a Kyte-Doolittle hydrophobicity value of approximately -0.733, indicating its membrane protein nature . Proper experimental validation of localization should include both biochemical and imaging-based approaches for comprehensive characterization.

How can researchers design experiments to investigate potential interactions between BamMC406_1828 and other Burkholderia proteins?

Investigating protein-protein interactions involving BamMC406_1828 requires specialized approaches for membrane proteins:

  • In vivo interaction methods:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Split-protein complementation assays (split-GFP, DHFR, luciferase)

    • In vivo crosslinking followed by co-immunoprecipitation

    • Förster resonance energy transfer (FRET) with fluorescent protein fusions

    • Proximity labeling approaches (BioID, APEX)

  • In vitro biochemical approaches:

    • Co-immunoprecipitation from solubilized membranes

    • Pull-down assays with recombinant proteins

    • Surface plasmon resonance (SPR) with reconstituted proteins

    • Isothermal titration calorimetry (ITC)

    • Microscale thermophoresis

  • Structural biology methods:

    • X-ray crystallography of protein complexes

    • Cryo-electron microscopy

    • Hydrogen-deuterium exchange mass spectrometry

    • NMR spectroscopy for specific domains

  • Systems biology approaches:

    • Genetic interaction screening

    • Synthetic lethality analysis

    • Co-expression network analysis

    • Computational prediction of protein-protein interactions

  • Functional validation:

    • Mutational analysis of interaction interfaces

    • Competitive inhibition assays

    • Reconstitution studies with purified components

Given that BamMC406_1828 is a probable intracellular septation protein, researchers should focus on potential interactions with other cell division proteins, membrane organization factors, and peptidoglycan synthesis machinery. The STRING database can be used to search for predicted protein-protein interactions involving BamMC406_1828 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.