Recombinant Burkholderia ambifaria Probable intracellular septation protein A (Bamb_1898)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Evolutionary Significance

The Bamb_1898 gene is part of the core genome of Burkholderia ambifaria, a species within the Bcc known for genomic plasticity and adaptive evolution . Comparative genomic studies of 116 Bcc strains identified Bamb_1898 as:

  • A single-copy ortholog with high conservation across Bcc species .

  • Subject to homologous recombination, a key driver of genetic diversification in Bcc .

  • Not directly linked to virulence factors but potentially involved in niche adaptation .

Recombination events in Bcc core genes like Bamb_1898 occur more frequently between species (67.1% of events) than within species (32.9%), blurring taxonomic boundaries .

Biotechnological and Agricultural Applications

While Bamb_1898’s specific role remains understudied, Burkholderia ambifaria is notable for its plant-protective metabolites (e.g., cepacin) and biocontrol potential . Key findings:

  • Biocontrol Efficacy: B. ambifaria strains inhibit fungal pathogens like Rhizoctonia cerealis via antifungal compounds (e.g., pyrrolnitrin) .

  • Safety: Deletion of non-essential replicons (e.g., plasmids) reduces pathogenicity in murine models while retaining biocontrol activity .

  • Plant Colonization: GFP-tagged B. ambifaria colonizes wheat tissues, enhancing growth and immune resistance .

Research Gaps and Future Directions

  • Functional Role: The precise mechanism of Bamb_1898 in septation requires experimental validation.

  • Pathogenicity Links: No direct evidence ties Bamb_1898 to virulence, but Bcc’s evolutionary plasticity warrants caution .

  • Agricultural Potential: Engineered B. ambifaria strains lacking pathogenic traits could leverage Bamb_1898 for sustainable biocontrol .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Bamb_1898; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD))
Target Names
Bamb_1898
Target Protein Sequence
MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGVANLYVVHNYTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Intracellular Septation Protein A in Burkholderia ambifaria?

Intracellular Septation Protein A (Bamb_1898) likely plays a critical role in the cell division process of Burkholderia ambifaria, specifically in septum formation. Based on homology with other bacterial septation proteins, it likely mediates the spatial organization and timing of septum development. Similar to mitotic-spindle organizing proteins like MztA, which has been shown to regulate septation in other organisms, Bamb_1898 may control the distribution and positioning of septa during cell division .

Methodologically, investigating this function requires:

  • Gene knockout studies to observe phenotypic changes in septum formation

  • Fluorescent tagging to visualize localization during cell division cycles

  • Quantitative analysis of septum spacing and positioning in wild-type versus mutant strains

  • Complementation studies to confirm that observed phenotypes are specifically due to Bamb_1898 loss

When conducting deletion studies, researchers should examine septum distribution using fluorescent dyes like Calcofluor white and implement quantitative measurements of septum spacing, similar to methodologies described for MztA .

How does Bamb_1898 differ structurally and functionally from septation proteins in other bacterial species?

While septation proteins are functionally conserved across bacterial species, Bamb_1898 likely possesses unique structural features reflecting the specific biology of Burkholderia ambifaria. As a member of the Burkholderia cepacia complex, B. ambifaria has been differentiated from other species through techniques including AFLP fingerprinting, whole-cell fatty acid analysis, and specific biochemical tests .

To methodologically investigate these differences:

  • Perform sequence alignment of septation proteins across bacterial species

  • Conduct phylogenetic analysis to understand evolutionary relationships

  • Compare predicted protein structures using computational tools like AlphaFold2

  • Perform functional complementation studies to determine if Bamb_1898 can rescue septation defects in other bacterial species

Researchers should note that B. ambifaria represents a distinct genomovar within the B. cepacia complex, with specific genetic markers that can be used for identification . These genetic differences may extend to septation proteins, potentially resulting in species-specific functional adaptations.

What experimental techniques are most effective for purifying recombinant Bamb_1898?

Purifying recombinant Bamb_1898 requires addressing several challenges common to full-length protein expression and purification. Based on established protocols for similar proteins:

Methodological approach:

  • Expression system optimization:

    • Test multiple expression vectors with different fusion tags (His, GST, MBP)

    • Create constructs with fusion tags at both N and C termini to distinguish full-length protein from truncated products

    • Optimize codon usage for the chosen expression system

  • Expression conditions:

    • Screen multiple bacterial strains (BL21(DE3), Rosetta, Arctic Express)

    • Test induction conditions (temperature: 16-37°C, IPTG concentration: 0.1-1.0 mM)

    • Consider autoinduction media for gradual protein expression

  • Purification strategy:

    • Implement a multi-step purification approach:
      a. Affinity chromatography (gradually increase imidazole concentration to prevent co-purification of truncated products)
      b. Ion-exchange chromatography to remove contaminants
      c. Size-exclusion chromatography for final polishing

  • Quality control:

    • Verify protein integrity by SDS-PAGE and Western blotting

    • Confirm identity by mass spectrometry

    • Assess folding status by circular dichroism

When encountering solubility issues, consider adding solubilizing agents or express as fusion proteins with solubility-enhancing tags, as these approaches have proven effective for challenging proteins .

How can researchers effectively analyze the septal localization of Bamb_1898 during cell division?

Visualizing Bamb_1898 localization during bacterial cell division provides critical insights into its function in septation. Based on established protocols for septation proteins:

Methodological approach:

  • Fusion protein construction:

    • Create C-terminal and/or N-terminal fluorescent protein fusions (GFP, mCherry)

    • Verify that fusion proteins retain functionality through complementation assays

    • Use inducible promoters to control expression levels

  • Sample preparation for microscopy:

    • Culture bacteria on glass coverslips in appropriate media

    • For fixed samples, use 4% paraformaldehyde as a fixative

    • Counterstain with membrane dyes (FM4-64) and DNA stains (DAPI)

  • Imaging protocols:

    • Implement time-lapse microscopy to track protein dynamics during the division cycle

    • Use Z-stack imaging to capture the complete three-dimensional structure

    • Apply deconvolution algorithms to enhance image clarity

  • Quantitative analysis:

    • Measure fluorescence intensity profiles across the cell length

    • Track protein localization over time relative to septum formation

    • Compare localization patterns in wild-type vs. mutant backgrounds

For optimal results, researchers should synchronize bacterial cultures to observe specific cell cycle stages and employ super-resolution microscopy techniques when available to resolve fine structural details of septal protein assemblies .

What challenges arise when expressing the full-length Bamb_1898 protein in heterologous systems?

Expression of full-length bacterial proteins like Bamb_1898 in heterologous systems presents several challenges that researchers should anticipate and address methodically:

Methodological considerations:

  • Protein solubility issues:

    • If insoluble inclusion bodies form, implement on-column refolding protocols

    • Test solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Optimize buffer conditions (pH, salt concentration, additives)

  • Translation initiation problems:

    • Address potential proteolysis by adding protease inhibitors

    • Optimize Shine-Dalgarno sequence and start codon context

    • Check for and modify internal ribosome binding sites that may cause truncation

  • Expression toxicity:

    • Use tightly regulated expression systems

    • Lower induction temperature (16-20°C)

    • Consider cell-free expression systems for highly toxic proteins

  • Verification approaches:

    • Use dual tagging (N and C-terminal) to confirm full-length expression

    • Employ mass spectrometry to verify molecular weight

    • Perform functional assays to confirm biological activity

The experimental design should incorporate systematic troubleshooting strategies, as expression challenges are common with proteins involved in critical cellular processes like septation. Researchers should be particularly vigilant about protein quality, as truncated or misfolded proteins may exhibit altered localization or function .

How do genetic interactions with other septation proteins inform Bamb_1898 function?

Understanding genetic interactions between Bamb_1898 and other septation-related proteins provides crucial insights into its functional role in the septation machinery network:

Methodological approach:

  • Genetic interaction mapping:

    • Create double knockouts with genes in related pathways

    • Perform synthetic lethal screens to identify essential interactions

    • Use CRISPR interference for partial knockdown of potential interaction partners

  • Suppressor screening:

    • Identify mutations that suppress Bamb_1898 deletion phenotypes

    • Screen for proteins that, when overexpressed, rescue septation defects

    • Analyze the functional categories of suppressors

  • Epistasis analysis:

    • Determine the order of action in the septation pathway

    • Establish whether Bamb_1898 functions upstream or downstream of other septation proteins

    • Compare phenotypes of single and double mutants to infer functional relationships

  • Protein-protein interaction validation:

    • Perform co-immunoprecipitation experiments

    • Use bacterial two-hybrid systems to confirm direct interactions

    • Implement fluorescence resonance energy transfer (FRET) to validate interactions in vivo

This approach parallels research on MztA, where deletion of the ParA gene was found to suppress the septation defects observed in MztA deletion mutants, revealing a functional relationship between these proteins . Similar genetic interaction studies for Bamb_1898 would help establish its position in the septation regulatory network.

What RNA-Seq experimental design would best identify the regulatory network involving Bamb_1898?

RNA-Seq analysis can reveal how Bamb_1898 fits into broader regulatory networks controlling cell division and septation:

Methodological approach:

  • Experimental design:

    • Compare transcriptomes of wild-type, Bamb_1898 deletion, and overexpression strains

    • Include multiple timepoints during the cell cycle

    • Incorporate environmental conditions relevant to B. ambifaria ecology

  • Sample collection and processing:

    • Harvest RNA at standardized growth phases

    • Implement ribosomal RNA depletion

    • Verify RNA quality using bioanalyzer or similar technology

  • Sequencing considerations:

    • Use paired-end sequencing for improved transcript assembly

    • Aim for 20-30 million reads per sample for adequate coverage

    • Include technical replicates to assess reproducibility

  • Data analysis pipeline:

    • Apply appropriate normalization methods for bacterial transcriptomes

    • Identify differentially expressed genes using packages like DESeq2 or edgeR

    • Perform gene ontology enrichment and pathway analysis

    • Construct gene co-expression networks to identify functional modules

  • Validation:

    • Confirm key expression changes with qRT-PCR

    • Verify protein-level changes for selected targets

    • Test predicted regulatory relationships through genetic manipulation

RNA-Seq has been successfully used to identify septation regulators in other organisms, as demonstrated in the identification of MztA as a positive septation regulator . Similar approaches would be valuable for mapping the Bamb_1898 regulatory network.

How should researchers design experiments to resolve contradictory data about Bamb_1898 function?

In scientific research, contradictory results regarding protein function are common and require systematic approaches to resolve:

Methodological approach:

  • Standardize experimental conditions:

    • Create detailed protocols specifying strain background, growth conditions, and assay parameters

    • Use identical reagents across laboratories

    • Implement blinded analysis to reduce experimental bias

  • Employ complementary methodologies:

    • If genetic approaches yield contradictory results, validate with biochemical methods

    • If in vitro studies conflict with in vivo observations, develop cell-based assays

    • Combine loss-of-function and gain-of-function approaches

  • Conduct dose-response studies:

    • Create conditional expression systems to analyze protein function at varying levels

    • Determine if phenotypes show threshold effects or linear relationships with protein levels

    • Test function across a range of environmental conditions

  • Controls and validation:

    • Include positive and negative controls in all experiments

    • Perform genetic complementation to confirm phenotype specificity

    • Use multiple independent mutant lines to ensure consistency

  • Collaborative cross-validation:

    • Establish collaborations between labs with contradictory results

    • Exchange materials and protocols to identify variables affecting outcomes

    • Consider publishing joint papers addressing discrepancies

This systematic approach allows researchers to determine whether contradictory results reflect true biological complexity or experimental variables, particularly important when studying proteins like Bamb_1898 that may have context-dependent functions.

What experimental approaches can distinguish between direct and indirect effects of Bamb_1898 on septum formation?

Distinguishing between direct and indirect effects is crucial for understanding the precise role of Bamb_1898 in septation:

Methodological approach:

  • Temporal analysis:

    • Use time-lapse microscopy to establish the sequence of events

    • Implement inducible expression systems to determine how quickly phenotypes appear after protein induction/depletion

    • Analyze early timepoint changes in gene expression following Bamb_1898 perturbation

  • Protein-protein interaction studies:

    • Use crosslinking approaches to capture transient interactions

    • Implement proximity labeling (BioID, APEX) to identify proteins in close proximity

    • Perform in vitro binding assays with purified components

  • Domain analysis:

    • Create targeted mutations in functional domains

    • Express individual domains to determine if they can function independently

    • Use chimeric proteins to swap domains with related septation proteins

  • Direct visualization:

    • Track Bamb_1898 localization relative to septum formation using fluorescent fusions

    • Implement super-resolution microscopy to determine precise spatial relationships

    • Use correlative light and electron microscopy to visualize protein in context of cellular ultrastructure

  • In vitro reconstitution:

    • Attempt to reconstitute minimal septation machinery in vitro

    • Test if adding purified Bamb_1898 directly affects septation components

    • Use model membrane systems to test interactions with lipid bilayers

This multi-faceted approach helps establish causal relationships and distinguish primary functions from secondary effects, critical for accurate characterization of septation proteins like Bamb_1898.

How should researchers quantitatively analyze septation defects in Bamb_1898 mutants?

Quantitative analysis of septation phenotypes is essential for understanding Bamb_1898 function:

Methodological approach:

  • Measurement parameters:

    • Septum frequency (number of septa per unit cell length)

    • Septum spacing (distance between adjacent septa)

    • Septum positioning (distance from cell poles)

    • Septum morphology (thickness, completeness, angle)

  • Imaging and staining:

    • Use Calcofluor white or other fluorescent dyes to visualize septa

    • Acquire Z-stack images to capture all septa

    • Implement phase contrast imaging to correlate with cell morphology

  • Quantification methods:

    • Develop automated image analysis workflows using ImageJ/FIJI or CellProfiler

    • Measure multiple cells (>100) for statistical power

    • Apply appropriate statistical tests (Student's t-test for comparing means)

  • Data visualization:

    • Create frequency distribution plots of septum spacing

    • Generate heat maps showing septum positions across cell populations

    • Present data using box plots to show distribution characteristics

  • Comparative analysis:

    • Compare with known septation mutants

    • Analyze under different growth conditions

    • Examine septation patterns in suppressor strains

Table 1: Quantitative Analysis Parameters for Septation Phenotypes

ParameterMeasurement MethodStatistical AnalysisVisualization Approach
Septum frequencyCount septa per cellCompare means with t-testBar charts with error bars
Septum spacingMeasure distance between adjacent septaCompare distributions with KS testBox plots showing median and quartiles
Septum positioningMeasure distance from cell polesAnalyze variance (ANOVA)Heat maps showing positional distribution
Septum morphologyScore completeness on scale (1-5)Non-parametric testsStacked bar charts showing morphology categories

This quantitative approach, similar to that used for analyzing MztA mutants , allows for rigorous comparison between wild-type and mutant strains, enabling researchers to precisely characterize septation defects.

What bioinformatic approaches can predict Bamb_1898 structure-function relationships?

Computational approaches provide valuable insights into protein structure and function before experimental validation:

Methodological approach:

  • Sequence analysis:

    • Perform multiple sequence alignment with homologs

    • Identify conserved domains and motifs

    • Use hydropathy analysis to predict membrane-associated regions

    • Analyze amino acid conservation across Burkholderia species

  • Structure prediction:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Validate models using quality assessment tools (MolProbity, VERIFY3D)

    • Identify potential functional sites through evolutionary conservation mapping

    • Analyze electrostatic surface properties

  • Molecular dynamics simulations:

    • Simulate protein behavior in membrane environments

    • Identify stable conformations and dynamic regions

    • Analyze potential binding sites through pocket detection algorithms

  • Interaction prediction:

    • Use protein-protein docking to predict binding partners

    • Apply co-evolution analysis to identify interacting residues

    • Analyze genomic context for functional associations

    • Implement machine learning approaches to integrate multiple prediction methods

  • Functional annotation transfer:

    • Use Gene Ontology terms from well-characterized homologs

    • Implement enzyme classification if catalytic activity is predicted

    • Map to known protein families and superfamilies

This comprehensive bioinformatic approach provides testable hypotheses about Bamb_1898 function that can guide experimental design and interpretation.

How can researchers determine if Bamb_1898 function is conserved across different Burkholderia species?

Determining functional conservation of Bamb_1898 across Burkholderia species provides evolutionary insights and potential therapeutic targets:

Methodological approach:

  • Comparative genomics:

    • Identify Bamb_1898 homologs across Burkholderia species

    • Analyze sequence conservation and selection pressure

    • Examine genomic context and gene neighborhood

    • Determine if the gene is part of the core or accessory genome

  • Cross-species complementation:

    • Express Bamb_1898 homologs from different species in B. ambifaria mutants

    • Test if homologs can rescue septation defects

    • Quantify the degree of functional rescue

    • Create chimeric proteins to identify species-specific functional domains

  • Expression pattern analysis:

    • Compare expression patterns across species using RT-qPCR

    • Determine if regulatory mechanisms are conserved

    • Identify species-specific expression conditions

  • Phenotypic comparison:

    • Create equivalent mutations in multiple Burkholderia species

    • Compare septation phenotypes quantitatively

    • Analyze growth rates and morphological changes

    • Test environmental condition responses

Table 2: Conservation Analysis of Bamb_1898 Across Burkholderia Species

SpeciesSequence Identity (%)Conserved DomainsCross-ComplementationExpression PatternSeptation Phenotype
B. ambifaria100 (reference)AllCompleteReferenceReference
B. cenocepacia85-90*All major domains*Partial*Similar to reference*Similar but not identical*
B. multivorans80-85*Missing C-terminal domain*Minimal*Condition-dependent*More severe defects*
B. vietnamiensis75-80*All with variations*Strain-dependent*Developmental differences*Quantitatively different*

*Hypothetical values for illustration purposes

As noted in research on the B. cepacia complex, species within this group show important genetic and functional differences despite close relationships . Understanding the conservation of septation proteins may provide insights into species-specific adaptations and potential therapeutic targets.

How might understanding Bamb_1898 function contribute to developing new antibacterial strategies?

Septation proteins represent potential targets for novel antibacterial development, particularly for difficult-to-treat pathogens:

Methodological approach to therapeutic applications:

  • Target validation:

    • Confirm essentiality of Bamb_1898 under various conditions

    • Assess conservation across pathogenic Burkholderia species

    • Determine if human homologs exist that might cause off-target effects

    • Evaluate effects of protein depletion on bacterial viability

  • High-throughput screening approaches:

    • Develop assays measuring septation that are amenable to high-throughput format

    • Screen compound libraries for molecules that inhibit Bamb_1898 function

    • Implement fragment-based screening approaches

    • Develop reporter systems to monitor septation in real-time

  • Structure-based drug design:

    • Identify druggable pockets in the Bamb_1898 structure

    • Design small molecule inhibitors targeting critical functional domains

    • Develop peptide inhibitors for protein-protein interaction interfaces

    • Use molecular dynamics to optimize inhibitor binding

  • Therapeutic considerations:

    • Test potential inhibitors against clinical isolates

    • Evaluate resistance development potential

    • Assess effects on non-pathogenic environmental strains

    • Consider ecological impact on beneficial Burkholderia strains

The dual nature of B. ambifaria as both a CF pathogen and a potentially beneficial biocontrol agent highlights the importance of developing targeted approaches that can distinguish between pathogenic and beneficial strains when considering therapeutic applications.

What emerging technologies could revolutionize the study of Bamb_1898 dynamics in live cells?

Emerging technologies offer new ways to study protein dynamics and function in living cells:

Methodological approach to advanced technologies:

  • Super-resolution microscopy:

    • Apply PALM/STORM imaging to visualize Bamb_1898 at nanometer resolution

    • Use structured illumination microscopy (SIM) for rapid live-cell imaging

    • Implement lattice light-sheet microscopy for extended live-cell imaging with reduced phototoxicity

  • Single-molecule tracking:

    • Employ photoactivatable fluorescent proteins for tracking individual molecules

    • Analyze diffusion patterns to infer binding interactions

    • Quantify residence times at septation sites

    • Determine stoichiometry of protein complexes in vivo

  • Proximity labeling technologies:

    • Implement APEX2 or BioID fusions to identify proximal proteins in vivo

    • Use split-BioID to detect specific protein-protein interactions

    • Apply temporal control to map dynamic interaction networks

    • Develop spatial proteomics approaches to determine protein localization

  • Cryo-electron tomography:

    • Image whole bacterial cells to visualize septation machinery in situ

    • Combine with subtomogram averaging for molecular detail

    • Correlate with fluorescence microscopy for protein localization

    • Visualize conformational changes during septation

These advanced technologies will provide unprecedented insights into the dynamic behavior of septation proteins like Bamb_1898 during bacterial cell division, potentially revealing mechanisms that cannot be detected using conventional approaches.

How can understanding the role of Bamb_1898 in B. ambifaria inform its pathogenicity in cystic fibrosis patients?

B. ambifaria has been isolated from cystic fibrosis (CF) patients, raising important questions about virulence factors and potential therapeutic targets:

Methodological approach:

  • Clinical isolate comparison:

    • Compare Bamb_1898 sequences between clinical and environmental isolates

    • Analyze gene expression in CF lung-mimicking conditions

    • Determine if septation patterns differ between clinical and environmental strains

    • Assess whether Bamb_1898 mutations correlate with increased virulence

  • Host-pathogen interaction studies:

    • Examine interactions with respiratory epithelial cells

    • Assess the role of Bamb_1898 in biofilm formation in CF-relevant conditions

    • Determine if Bamb_1898 affects antibiotic tolerance

    • Investigate host immune response to wild-type versus mutant strains

  • Safety assessment for biocontrol applications:

    • Evaluate whether targeting Bamb_1898 could differentiate pathogenic from beneficial strains

    • Assess environmental impact of potential Bamb_1898 inhibitors

    • Investigate potential for horizontal gene transfer between environmental and clinical strains

    • Develop containment strategies for biocontrol applications

  • Therapeutic implications:

    • Evaluate Bamb_1898 as a potential drug target for CF infections

    • Design inhibitors with specificity for pathogenic strains

    • Assess combination therapy approaches targeting septation and other processes

    • Develop diagnostic tools to identify high-risk strains

The dual nature of B. ambifaria as both a CF pathogen and a potentially beneficial biocontrol agent highlights the importance of understanding septation proteins in different contexts . This understanding could lead to strategies that permit the beneficial use of B. ambifaria while minimizing risk to vulnerable populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.