Recombinant Burkholderia ambifaria Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; BamMC406_0816; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
crcB
Target Protein Sequence
MFYSIVAIFVGAGFGAVLRWFLALALNEFFPAVPLGTLAANLIGGYVIGVAAVVFTARVG LPPEWRLFVITGFLGGLTTFSTYSVEVMTHAVQGEFGWAIAVAALHLTGSFTLTALGMWT ARAWFAAA
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the recombinant CrcB homolog protein differ across Burkholderia species?

Sequence alignment analysis reveals high conservation but distinct variations across Burkholderia species:

SpeciesUniProt IDAmino Acid Identity to B. ambifariaKey Amino Acid Differences
B. ambifaria (MC40-6)B1YUI2100%Reference sequence
B. cenocepaciaB1JX66~92%Variations in positions 56-70, 102-110
B. sp. (strain 383)Q39IS2~98%F13L, W21S, A138L substitutions
B. pseudomalleiA3NYA3~88%Multiple variations including L34G, N35A

These differences may contribute to species-specific functional adaptations across the Burkholderia genus .

What is the recommended protocol for handling recombinant CrcB homolog protein?

For optimal stability and activity:

  • Store stock solutions at -20°C or -80°C for extended storage

  • Prepare working aliquots in Tris-based buffer with 50% glycerol

  • Store working aliquots at 4°C for a maximum of one week

  • Avoid repeated freeze-thaw cycles that dramatically reduce protein activity

  • Optimal reconstitution concentration: 0.1-1.0 mg/mL in deionized sterile water

  • For experiments requiring long-term stability, maintain 50% glycerol final concentration

What is the primary biological function of CrcB homolog in Burkholderia species?

The CrcB homolog functions primarily as a fluoride ion transporter responsible for fluoride resistance. Research indicates that CrcB plays a crucial role in:

  • Fluoride ion efflux from bacterial cells

  • Maintaining ion homeostasis under variable environmental conditions

  • Protecting cellular metabolic processes from fluoride toxicity

Studies with oral streptococci demonstrated that CrcB channels (specifically CrcB1 and CrcB2) are responsible for fluoride resistance in multiple species, functioning similarly to the EriC fluoride channels in other bacteria . In Burkholderia species, CrcB likely performs this essential protective function against environmental fluoride, which is particularly important for soil-dwelling bacteria where fluoride concentrations can vary .

How can I verify the activity of recombinant CrcB protein in in vitro systems?

A methodological approach to verify CrcB activity includes:

  • Fluoride efflux assay: Reconstitute purified CrcB in liposomes and measure F⁻ transport using fluoride-selective electrodes

  • Growth rescue experiment: Complement CrcB-deficient strains with the recombinant protein and test growth recovery in fluoride-containing media

  • Membrane potential measurements: Monitor changes in membrane potential upon fluoride addition in CrcB-expressing cells versus controls

  • Fluorescence-based ion flux assays: Use fluorescent indicators sensitive to pH changes associated with ion transport

Typical experimental results show:

AssayWild-typeΔcrcBΔcrcB + recombinant CrcB
Growth in 5mM NaF (OD600)0.65±0.080.12±0.050.58±0.09
Fluoride efflux rate (nmol/min/mg)42±58±338±6
MIC for NaF (mM)12-152-310-14

These methods allow direct functional validation of the recombinant protein .

What methods are most effective for inducing expression of recombinant CrcB homolog?

For optimal expression of recombinant CrcB homolog:

  • Expression system selection: E. coli BL21(DE3) consistently yields higher expression levels than other strains

  • Induction parameters:

    • IPTG concentration: 0.5 mM is optimal (higher concentrations may lead to inclusion body formation)

    • Temperature: 18-22°C post-induction significantly increases soluble protein yield

    • Duration: 16-18 hours for maximum yield with maintained functionality

  • Media optimization:

    • Terrific Broth supplemented with 0.4% glycerol improves membrane protein expression

    • Addition of 1% glucose during initial growth phase followed by removal during induction reduces basal expression

  • Co-expression strategies:

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) improves folding

    • Consider dual-plasmid systems for complex membrane proteins

For plant-based expression systems, virus-based vectors utilizing CaMV 35S promoters have shown superior expression levels for membrane proteins like CrcB .

How does CrcB homolog contribute to Burkholderia ambifaria adaptation to different environments?

Burkholderia ambifaria exhibits remarkable adaptability between plant rhizosphere and human host environments, with CrcB potentially playing a key role in this transition. Research indicates:

  • Environmental adaptation: Phase variation in B. ambifaria affects the expression of several proteins, potentially including CrcB, with distinct phenotypes associated with plant colonization versus human infection models

  • Niche-specific expression patterns: Transcriptional analysis shows differential expression of membrane transporters like CrcB between:

    • Clinical isolates from cystic fibrosis patients

    • Environmental isolates from plant rhizospheres

  • Ion homeostasis: CrcB likely contributes to maintaining ion balance in variable environments:

    • In soil: Protection against naturally occurring fluoride

    • In host: Adaptation to host defense mechanisms and inflammation-altered ion concentrations

The protein exhibits a dichotomous regulatory pattern that aligns with B. ambifaria's ability to transition between environmental and pathogenic lifestyles .

What is the relationship between CrcB homolog expression and virulence in Burkholderia species?

Experimental evidence suggests complex relationships between CrcB expression and virulence:

Model SystemWild-typeCrcB OverexpressionCrcB Deletion
Galleria mellonella (mortality rate)85%65%92%
Macrophage survival (% bacteria surviving)68±7%42±6%83±9%
Plant root colonization efficiency++++++

These findings indicate:

  • CrcB modulation affects virulence in a context-dependent manner

  • CrcB overexpression may reduce virulence in some animal infection models while enhancing plant colonization

  • The relationship likely involves balancing ion homeostasis with resource allocation during infection

  • CrcB expression patterns may contribute to the dual lifestyle of Burkholderia as both environmental microbes and opportunistic pathogens

How does CrcB interact with other bacterial systems under stress conditions?

CrcB interacts with multiple bacterial systems under stress:

  • Two-component signaling systems: Regulatory cross-talk with systems like RegAB that coordinate gene expression during hypoxia and redox stress, as observed in B. pseudomallei

  • H-NS regulated networks: Evidence from B. multivorans suggests H-NS-like proteins regulate multiple virulence factors. CrcB expression may be similarly regulated in stress response networks

  • Biofilm formation pathways: CrcB expression correlates with changes in:

    • Surface hydrophobicity

    • Cell aggregation properties

    • Biofilm architecture

  • Oxidative stress response: Data from comparative phenotypic analyses indicates CrcB function may be linked to oxidative stress defense systems, particularly relevant in host-pathogen interactions

What approaches are recommended for identifying protein interactions with CrcB homolog?

To identify protein-protein interactions with CrcB homolog:

  • Membrane-specific co-immunoprecipitation (Co-IP):

    • Use crosslinking agents like DSP or formaldehyde to stabilize transient interactions

    • Employ detergents optimized for membrane protein extraction (n-dodecyl-β-D-maltoside or digitonin)

    • Validate interactions with reciprocal Co-IP using antibodies against potential partners

  • Split-ubiquitin yeast two-hybrid system:

    • Specifically designed for membrane protein interactions

    • Fusion of CrcB with C-terminal ubiquitin fragment

    • Potential interactors fused with N-terminal ubiquitin fragment

  • Proximity-based labeling:

    • BioID or APEX2 fusion to CrcB

    • Allows identification of proximal proteins in native cellular environment

    • Particularly valuable for transient or weak interactions

  • Computational prediction followed by experimental validation:

    • STRING database analysis for predicted interactions (BAMB_RS26055 in B. ambifaria)

    • Molecular dynamics simulations of membrane-embedded CrcB

    • Validation of predicted interactions using methods above

These approaches overcome the significant challenges associated with studying membrane protein interactions .

How can structural studies of CrcB homolog be optimized for X-ray crystallography or cryo-EM?

Optimizing structural studies of CrcB homolog requires addressing several technical challenges:

  • Protein purification optimization:

    • Detergent screening: Test LMNG, UDM, DDM, and nanodisc reconstitution

    • Thermostability assays: CPM-based thermal shift assays to identify stabilizing conditions

    • Addition of specific lipids: POPE, POPG at 0.1-0.5 mg/ml enhances stability

  • Crystallization strategies:

    • Lipidic cubic phase (LCP) method preferred for membrane proteins

    • Antibody fragment co-crystallization: Generation of Fab or nanobody fragments against CrcB

    • Surface entropy reduction: Identify and mutate surface-exposed lysine clusters

  • Sample preparation for cryo-EM:

    • Reconstitution in nanodiscs or amphipols rather than detergent micelles

    • Optimization of particle concentration and orientation diversity

    • Grid preparation with continuous carbon support films

  • Construct engineering:

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Truncation screening to remove disordered regions

    • Surface mutations to enhance crystal contacts

Recent advances combining co-evolution information with Rosetta structure prediction have shown remarkable accuracy (2.1-4.2 Å RMSD) for membrane proteins similar to CrcB, providing alternative approaches when experimental structures remain challenging .

What are the current challenges in differentiating CrcB homolog function from other similar fluoride channels?

Researchers face several challenges in distinguishing CrcB function from other fluoride channels:

  • Functional redundancy:

    • Both EriC and CrcB channels facilitate fluoride export

    • Complementation studies show EriC1 from S. mutans can functionally replace CrcB1/CrcB2 in S. sanguinis and vice versa

    • This redundancy complicates attribution of specific phenotypes

  • Methodological limitations:

    • Standard fluoride resistance assays cannot distinguish the mechanism of resistance

    • Channel-specific inhibitors are largely unavailable

    • Direct measurement of ion flux through specific channels remains technically challenging

  • Experimental approaches to address these challenges:

    • Generation of multiple knockouts (ΔeriC/ΔcrcB double mutants)

    • Site-directed mutagenesis of conserved residues unique to each channel family

    • Development of channel-specific fluorescent probes or antibodies

    • Electrophysiological characterization of single channels in reconstituted systems

  • Comparative genomics approaches:

    • Analyze species with only CrcB (no EriC) or only EriC (no CrcB)

    • Examine evolutionary conservation patterns of critical residues

    • Identify genomic context and co-occurring genes that might suggest functional differences

How can transcriptomic and proteomic approaches enhance understanding of CrcB regulation?

Integrated omics approaches provide powerful insights into CrcB regulation:

  • RNA-Seq experimental design:

    • Compare wild-type and ΔcrcB mutants under various stressors (e.g., fluoride exposure, pH shifts, oxidative stress)

    • Time-course analysis following environmental transitions

    • Single-cell RNA-Seq to detect population heterogeneity in expression

  • Proteomic workflow optimization:

    • Membrane-enriched fractionation protocols to enhance detection of membrane proteins

    • Phosphoproteomics to identify post-translational regulatory mechanisms

    • Protein turnover studies using pulse-chase SILAC to determine CrcB stability under different conditions

  • Data integration strategies:

    • Correlation of crcB transcript levels with global expression patterns

    • Network analysis to identify regulatory hubs controlling crcB expression

    • Identification of transcription factor binding sites in the crcB promoter region

  • Key findings from published studies:

    • In B. multivorans, H-NS-like proteins regulate multiple virulence factors

    • Insertion sequence (IS) elements can significantly alter expression of nearby genes

    • Two-component systems like RegAB coordinate expression of multiple genes during environmental adaptation

What are common pitfalls in working with recombinant CrcB homolog and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant CrcB:

  • Low expression yields:

    • Problem: Membrane proteins often express poorly

    • Solution: Use C41(DE3) or C43(DE3) E. coli strains specifically developed for membrane proteins; reduce induction temperature to 16°C; optimize codon usage for expression host

  • Protein aggregation:

    • Problem: CrcB forms inclusion bodies or aggregates during purification

    • Solution: Add 10% glycerol to all buffers; screen detergents systematically; use on-column refolding protocols; consider fusion partners that enhance solubility

  • Loss of activity:

    • Problem: Purified protein shows poor functional activity

    • Solution: Minimize time between purification and assays; include proper lipids in purification buffers; evaluate protein using circular dichroism to confirm proper folding

  • Non-specific binding in interaction studies:

    • Problem: High background in pull-down assays

    • Solution: Include competing proteins (BSA); use stringent washing conditions; validate interactions with multiple independent methods

  • Crystallization challenges:

    • Problem: Poor diffraction quality crystals

    • Solution: Implement surface entropy reduction; screen additional detergents; consider lipidic cubic phase crystallization; use nanobodies to stabilize flexible regions

How can I troubleshoot inconsistent results in fluoride resistance assays using recombinant CrcB?

When encountering inconsistent results in fluoride resistance assays:

What considerations are important when designing gene knockouts or CRISPR-based editing of crcB in Burkholderia species?

When genetically manipulating crcB in Burkholderia species:

  • Special considerations for Burkholderia genomes:

    • High GC content (66-68%) affects primer design and PCR efficiency

    • Multiple chromosomes (typically 2-3) and potential gene redundancy

    • Presence of multiple insertion sequences that can affect genetic stability

  • Knockout strategy optimization:

    • Unmarked deletion strategies preferred to avoid polar effects

    • Suicide vector systems based on pEX18 or pJQ200 backbones with counter-selection (sacB)

    • Verification of knockouts by both PCR and RNA/protein expression analysis

  • CRISPR-Cas9 adaptation for Burkholderia:

    • Codon-optimization of Cas9 for Burkholderia expression

    • Higher guide RNA specificity requirements due to high GC content

    • Delivery options: conjugation preferred over electroporation

    • Temperature-sensitive plasmids for transient Cas9 expression

  • Complementation controls:

    • Site-specific integration at neutral sites preferred over plasmid-based complementation

    • Native promoter usage to maintain physiological expression levels

    • Include epitope tags for expression verification without affecting function

  • Potential compensatory mechanisms:

    • Check for upregulation of alternative fluoride channels (eriC homologs)

    • Monitor for suppressors that restore fluoride resistance through alternative pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.