Recombinant Burkholderia cenocepacia 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Burkholderia cenocepacia 4-hydroxybenzoate octaprenyltransferase (ubiA) is a transmembrane protein belonging to the UbiA superfamily of intramembrane aromatic prenyltransferases . The enzyme is encoded by the ubiA gene located on chromosome 1 of Burkholderia cenocepacia, with genomic location varying by strain. In the MC0-3 strain, for instance, it is positioned at coordinates 765848-766711 on the positive strand . The protein is officially designated as 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.-) and is alternatively known as 4-HB polyprenyltransferase .

The UbiA superfamily encompasses a diverse group of enzymes that catalyze prenylation reactions essential for the biosynthesis of various bioactive compounds, including ubiquinones, menaquinones, plastoquinones, hemes, chlorophylls, vitamin E, and structural lipids . These compounds serve critical functions in cellular processes such as respiration, photosynthesis, and antioxidant defense, highlighting the biological significance of ubiA and related enzymes.

Physical and Chemical Characteristics

The biochemical properties of Burkholderia cenocepacia ubiA provide insight into its behavior in biological systems and experimental settings. Based on the available data for the MC0-3 strain, the enzyme possesses distinct physical and chemical characteristics that influence its functionality.

Table 1: Physical and Chemical Properties of Burkholderia cenocepacia ubiA (strain MC0-3)

PropertyValueSource
Molecular Weight31,884.3 Da
Isoelectric Point (pI)9.27
Charge at pH 76.82
Kyte-Doolittle Hydrophobicity Value0.624

The relatively high hydrophobicity value aligns with the protein's transmembrane localization, while the basic isoelectric point and positive charge at physiological pH suggest interactions with negatively charged molecules, potentially including its substrates or membrane components.

Enzymatic Activity

As a member of the UbiA superfamily, Burkholderia cenocepacia 4-hydroxybenzoate octaprenyltransferase catalyzes the prenylation of 4-hydroxybenzoate (PHB), a key step in ubiquinone biosynthesis . While specific kinetic parameters for the Burkholderia cenocepacia enzyme are not directly provided in the search results, insights can be drawn from studies of the Escherichia coli homolog (EcUbiA).

The enzymatic reaction requires divalent metal ions, with magnesium being the preferred cofactor . The apparent Km values for PHB and geranyldiphosphate (GPP) typically fall in the submillimolar range, with higher affinity observed for longer isoprenyldiphosphates . The enzyme exhibits regiospecificity, catalyzing prenylation exclusively at the meta-position of the aromatic ring. Importantly, while the enzyme maintains strict requirements for the benzoate group, it demonstrates some flexibility regarding PHB derivatives, provided the para-benzene group can function as an electron and hydrogen bond donor .

Expression Systems and Purification

Recombinant Burkholderia cenocepacia ubiA is typically produced using in vitro Escherichia coli expression systems . The recombinant protein may include affinity tags to facilitate purification, such as the N-terminal 10xHis-tag mentioned in one commercial preparation . These tags enable efficient purification through affinity chromatography while maintaining the protein's structural integrity and function.

The expression region typically encompasses the full-length protein (residues 1-287), ensuring complete structural and functional integrity . Various commercial preparations of the recombinant protein are available, each with specific product codes and potentially different tag configurations optimized for particular applications.

Role in Ubiquinone Biosynthesis

The primary biological function of ubiA is to catalyze a critical step in ubiquinone biosynthesis. Ubiquinones (also known as coenzyme Q) are lipid-soluble electron carriers essential for cellular respiration and energy production. The prenylation reaction catalyzed by ubiA is fundamental to the formation of the ubiquinone skeleton, enabling the molecule to properly integrate into the membrane environment where it functions .

The enzyme catalyzes the addition of a polyprenyl side chain to 4-hydroxybenzoate, creating a lipophilic molecule that can associate with the lipid bilayer. The length of this side chain can vary depending on the organism, with bacteria typically producing shorter chains than eukaryotes. This prenylation reaction represents a critical point in the ubiquinone biosynthetic pathway, as it bridges the aqueous and membrane-bound phases of the process.

Broader Context within the UbiA Superfamily

The UbiA superfamily encompasses enzymes involved in the biosynthesis of various essential biomolecules beyond ubiquinones, including menaquinones, plastoquinones, hemes, chlorophylls, vitamin E, and structural lipids . These compounds play crucial roles in cellular processes such as electron transport, photosynthesis, antioxidant defense, and membrane structure.

The evolutionary conservation of this enzyme family across diverse organisms highlights the fundamental importance of prenylation reactions in biological systems. In humans, mutations in the homologous COQ2 gene can lead to infantile multisystem disease, underscoring the critical nature of this enzymatic activity in human health . Similarly, the human homolog UBIAD1 has been linked to various conditions, including cardiovascular degeneration, Parkinson's disease, Schnyder corneal dystrophy, and urologic cancers .

Structure-Function Relationships

While detailed structural information specific to Burkholderia cenocepacia ubiA is not provided in the search results, insights can be drawn from studies of other UbiA superfamily members. These enzymes typically feature multiple transmembrane domains that create a hydrophobic environment suitable for handling lipophilic substrates.

The prenylation mechanism involves the cleavage of the diphosphate group from the prenyl donor, followed by the formation of a carbon-oxygen bond with the aromatic acceptor . This reaction occurs within the membrane, allowing the resulting prenylated product to remain in the lipophilic environment where it will function.

Crystal structures of UbiA superfamily members have revealed distinctive substrate preferences, suggesting specific structural features that determine substrate recognition and binding . These structures provide valuable insights into the general mechanism of substrate recognition within this enzyme family, although specific details for Burkholderia cenocepacia ubiA would require dedicated structural studies.

Metal Ion Dependence

Like other members of the UbiA superfamily, Burkholderia cenocepacia ubiA likely depends on divalent metal ions for catalytic activity. Studies of Escherichia coli UbiA have shown a preference for magnesium ions as cofactors in the prenylation reaction . These metal ions likely facilitate the cleavage of the diphosphate group from the prenyl donor, a critical step in the enzymatic mechanism.

The metal ion dependence represents an important aspect of the enzyme's biochemistry and potentially offers a point of regulation or inhibition that could be exploited in research or therapeutic applications. Understanding these mechanistic details provides a foundation for studying the enzyme's function and developing strategies to modulate its activity.

Basic Research Applications

Recombinant Burkholderia cenocepacia ubiA serves as a valuable tool for basic research into ubiquinone biosynthesis and the broader functions of the UbiA superfamily. The availability of the purified enzyme enables detailed biochemical studies, including:

  1. Kinetic analyses to determine substrate preferences and reaction rates

  2. Inhibitor screening to identify molecules that modulate enzyme activity

  3. Structure-function studies to elucidate the molecular basis of substrate recognition and catalysis

  4. Comparative biochemistry to understand evolutionary relationships within the UbiA superfamily

These fundamental investigations contribute to our understanding of essential cellular processes and provide insights into the molecular mechanisms underlying various biological phenomena.

Potential Therapeutic Applications

Given the involvement of UbiA superfamily members in human diseases, research on Burkholderia cenocepacia ubiA may have implications for therapeutic development. While the bacterial enzyme itself is not directly targeted in human therapies, insights gained from studying its structure and function can inform approaches to modulating its human homologs.

For instance, understanding the catalytic mechanism and substrate recognition features of bacterial ubiA can provide a foundation for developing interventions targeting human COQ2 or UBIAD1, which have been implicated in various pathological conditions . Such applications represent the translational potential of basic research on this enzyme family.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
ubiA; Bcen2424_0729; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
ubiA
Target Protein Sequence
MLARFPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGRPRWPLLVIFTLGTLLMRSAGCA MNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVGLSFIAFLLILPLNTLTKELSVVA LFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMLAWVMLVANIFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAVMACYAATLGIYVWIGVTLGFGLAYWVGWAA AVGCALYHYTLIKDRERMPCFAAFRHNNWLGGVLFAGIAAHYLLAGN
Uniprot No.

Target Background

Function
This recombinant Burkholderia cenocepacia 4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia cenocepacia and why is it significant in research?

Burkholderia cenocepacia is a Gram-negative bacterial species belonging to the Burkholderia cepacia complex (Bcc), a group of 22 related bacterial species widespread in the environment. B. cenocepacia has significant research importance due to its role as an opportunistic pathogen in cystic fibrosis (CF) patients, where it can cause severe decline in lung function and potentially develop into a life-threatening systemic infection known as cepacia syndrome . The bacterium is characterized by its extreme antibiotic resistance, environmental versatility, and unique genomic adaptability. B. cenocepacia typically inhabits the rhizosphere and is related to the onion pathogen B. cepacia, demonstrating its broad host range .

Research on B. cenocepacia is particularly valuable because this organism represents a model for studying bacterial adaptation across diverse ecological niches (soil, plant tissue, human lungs) and exemplifies the challenges in treating multi-drug resistant bacterial infections. The bacterium contains numerous virulence determinants and possesses a complex genome that makes it both scientifically interesting and clinically concerning .

What is the role of 4-hydroxybenzoate octaprenyltransferase (UbiA) in B. cenocepacia metabolism?

4-hydroxybenzoate octaprenyltransferase (UbiA) is a key enzyme in the ubiquinone (coenzyme Q) biosynthetic pathway in B. cenocepacia. This enzyme catalyzes a critical prenylation reaction where 4-hydroxybenzoate is conjugated with an octaprenyl diphosphate substrate to form 3-octaprenyl-4-hydroxybenzoate. This represents a crucial step in the production of ubiquinone, an essential component of the bacterial electron transport chain.

In B. cenocepacia, UbiA function is particularly important because:

  • Ubiquinone is essential for aerobic respiration and energy production, especially in the oxygen-limited environment of CF lung mucus

  • The enzyme plays a role in maintaining cellular redox balance under oxidative stress conditions

  • Ubiquinone biosynthesis contributes to bacterial membrane integrity and stability

  • The pathway may interface with virulence mechanisms and stress responses that aid pathogen survival

How does UbiA expression change during host adaptation in B. cenocepacia?

During host adaptation, B. cenocepacia undergoes significant physiological and genetic changes to optimize survival in new environments. While specific UbiA expression patterns during host adaptation aren't directly described in the literature, we can infer likely patterns based on adaptation studies:

Experimental evolution of B. cenocepacia in macerated onion tissue for 1,000 generations demonstrates that adaptation to a specific host environment involves substantial metabolic rewiring . Populations showed significant phenotypic variation in several host association traits, including motility, biofilm formation, and quorum-sensing function . These adaptations suggest that metabolic enzymes like UbiA likely undergo expression changes to accommodate:

  • Altered energy requirements in new host environments

  • Different oxygen availability between soil, plant, and human hosts

  • Modified membrane composition requirements to resist host defense mechanisms

  • Changes in electron transport chain components needed for different energy sources

Interestingly, adaptation to onion tissue was consistently accompanied by a loss of pathogenicity to the nematode Caenorhabditis elegans, suggesting that metabolic adaptation to one host may compromise virulence in others .

What expression systems are most effective for recombinant B. cenocepacia UbiA?

For heterologous expression of recombinant B. cenocepacia UbiA, several expression systems can be considered, each with specific advantages:

E. coli Expression Systems:

Specialized Approaches for UbiA:

  • Addition of fusion tags (MBP, SUMO) to improve solubility

  • Co-expression with chaperones (GroEL/GroES) to aid proper folding

  • Engineering constructs with optimized signal sequences for proper membrane insertion

  • Low-temperature induction (16°C) to improve folding of membrane proteins

For UbiA, which is an integral membrane protein, selection of suitable detergents for extraction and purification is critical. Methodologies successful with other prenyl transferases suggest using mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) during purification to maintain native conformation and activity.

What purification strategies yield the highest activity for recombinant UbiA?

Purification of recombinant UbiA requires specialized approaches due to its membrane-associated nature. The following stepwise strategy is recommended:

  • Membrane Preparation:

    • Harvest cells and disrupt by sonication or French press

    • Separate membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Wash membrane fraction to remove peripheral proteins

  • Solubilization:

    • Solubilize membranes with appropriate detergent mixtures (1-2% DDM with 0.1-0.5% CHS)

    • Perform solubilization at 4°C with gentle agitation for 2-4 hours

    • Remove insoluble material by ultracentrifugation

  • Affinity Chromatography:

    • Use immobilized metal affinity chromatography (IMAC) for His-tagged UbiA

    • Maintain critical micellar concentration (CMC) of detergent in all buffers

    • Include stabilizing agents such as glycerol (10-15%) and suitable lipids

  • Size Exclusion Chromatography:

    • For higher purity, perform SEC as a polishing step

    • Assess protein homogeneity and oligomeric state

    • Monitor activity throughout purification steps

Activity Preservation Strategy:

ComponentConcentrationPurpose
Detergent (DDM)0.03-0.05%Maintain solubility
Phospholipids (E. coli extract)0.1-0.5 mg/mlStabilize native conformation
Glycerol10-15%Prevent protein aggregation
DTT or βME2-5 mMMaintain reduced state of cysteines
NaCl150-300 mMIonic strength stabilization
pH buffer50 mM, pH 7.5-8.0Optimal enzymatic activity

Throughout the purification process, it is essential to monitor protein stability and enzymatic activity to ensure the preservation of UbiA function.

What assays can be used to measure UbiA activity in vitro?

Several complementary assays can be employed to measure recombinant B. cenocepacia UbiA activity in vitro:

1. Radiolabeled Substrate Incorporation Assay:

  • Principle: Measures incorporation of 14C-labeled 4-hydroxybenzoate into prenylated products

  • Methodology: Incubation of purified UbiA with 14C-4-hydroxybenzoate and octaprenyl diphosphate, followed by organic extraction and scintillation counting

  • Advantages: High sensitivity; quantitative; direct measurement of catalysis

  • Limitations: Requires radioactive materials; specialized disposal procedures

2. HPLC-Based Activity Assay:

  • Principle: Separation and quantification of substrate consumption and product formation

  • Methodology: Reverse-phase HPLC with UV detection (λ = 254 nm) for 4-hydroxybenzoate and prenylated products

  • Advantages: Non-radioactive; allows product characterization; suitable for kinetic analysis

  • Limitations: Requires product standards; lower sensitivity than radioactive assays

3. Coupled Enzyme Assay:

  • Principle: Measures pyrophosphate release during prenylation reaction

  • Methodology: Coupling pyrophosphate release to enzymatic reactions that generate a colorimetric or fluorescent signal

  • Advantages: Continuous measurement; suitable for high-throughput screening

  • Limitations: Potential for interference from coupling enzymes; indirect measurement

4. LC-MS/MS Assay:

  • Principle: Mass-based detection and quantification of substrates and products

  • Methodology: Liquid chromatography followed by tandem mass spectrometry

  • Advantages: High specificity; can detect multiple reaction products; no need for radiolabeled substrates

  • Limitations: Requires specialized equipment; more complex data analysis

For comprehensive characterization, a combination of these assays provides the most complete understanding of UbiA activity, with radiochemical assays providing the gold standard for specific activity determination, while HPLC and LC-MS methods offer detailed product characterization.

What structural features differentiate B. cenocepacia UbiA from other bacterial homologs?

While detailed structural information specific to B. cenocepacia UbiA is not widely available in the literature, comparison with related UbiA homologs from other bacteria reveals key structural features that likely apply to the B. cenocepacia enzyme:

Conserved Structural Elements:

  • Transmembrane α-helical bundle architecture (typically 9 transmembrane domains)

  • Central hydrophobic cavity for substrate binding

  • Two Asp-rich motifs (NxxDxxxD) critical for magnesium coordination and catalysis

  • Distinct binding pockets for 4-hydroxybenzoate and prenyl diphosphate substrates

Predicted Distinctive Features of B. cenocepacia UbiA:
Given B. cenocepacia's extreme antibiotic resistance and adaptability to diverse environments , its UbiA likely possesses modifications that optimize function under various conditions:

  • Altered substrate binding pocket dimensions to accommodate the specific prenyl diphosphate chain length preferences

  • Modified surface residues that facilitate interaction with membrane lipids specific to B. cenocepacia

  • Potential regulatory sites that respond to environmental signals during host adaptation

  • Structural elements that confer stability under stress conditions encountered during infection

Implications for Inhibitor Design:
The unique structural features of B. cenocepacia UbiA could be exploited for species-specific inhibitor development. Targeting regions that differ from human homologs while maintaining specificity for B. cenocepacia UbiA over other bacterial homologs represents a promising approach for therapeutic development.

How can molecular modeling guide the design of selective UbiA inhibitors?

Molecular modeling approaches provide valuable insights for the rational design of selective inhibitors targeting B. cenocepacia UbiA:

Homology Modeling Workflow:

  • Template selection from structurally characterized UbiA homologs

  • Sequence alignment optimization focusing on conserved catalytic motifs

  • Model building incorporating B. cenocepacia-specific sequence features

  • Refinement with membrane environment simulation

  • Validation through energy minimization and structural analysis

Virtual Screening Strategy:

ApproachMethodologyAdvantagesConsiderations
Structure-basedDocking against active siteDirect targeting of catalytic siteRequires accurate structural model
Ligand-basedPharmacophore modeling from known substratesCan proceed without complete structural dataMay miss novel binding modes
Fragment-basedIn silico fragment screening and linkingDiscovers novel chemotypesRequires experimental validation
Molecular dynamicsSimulating protein-ligand interactionsAccounts for protein flexibilityComputationally intensive

Selectivity Design Principles:
To develop inhibitors selective for B. cenocepacia UbiA over human homologs or other bacterial enzymes, computational approaches should focus on:

  • Identifying unique binding pocket features through structural comparison

  • Targeting non-conserved residues adjacent to the catalytic site

  • Exploiting differences in membrane-protein interactions

  • Designing compounds that leverage B. cenocepacia-specific access channels to the active site

Molecular dynamics simulations incorporating membrane environments are particularly valuable for understanding the dynamic behavior of UbiA and identifying transient binding pockets that may not be evident in static models.

How does UbiA expression respond to environmental adaptation and stress in B. cenocepacia?

The regulation of UbiA expression during environmental adaptation represents an important area of research, especially considering B. cenocepacia's remarkable adaptability:

Environmental Adaptation Patterns:
Experimental evolution studies with B. cenocepacia demonstrate that adaptation to specific environments (such as onion tissue) results in significant phenotypic changes, including alterations in biofilm formation and quorum sensing . These adaptations suggest metabolic reprogramming that likely affects ubiquinone biosynthesis pathways:

  • Oxygen availability response: When B. cenocepacia transitions between aerobic and microaerobic environments (as in CF lungs), UbiA expression likely changes to optimize electron transport chain function

  • Nutrient availability adaptation: Different carbon sources in various host environments may trigger metabolic shifts that alter ubiquinone requirements

  • Host defense response: Adaptation to antimicrobial peptides and oxidative stress involves membrane modifications that may affect UbiA expression and function

Stress Response Connection:
B. cenocepacia employs the alternative sigma factor RpoE to control genes involved in extra-cytoplasmic stress response . The relationship between this stress response system and ubiquinone biosynthesis represents an intriguing research direction, as energy production and membrane integrity are critical for surviving stress conditions.

Experimental Approaches to Study UbiA Regulation:

  • Transcriptomics to measure ubiA expression under various environmental conditions

  • Reporter gene fusions to monitor ubiA promoter activity in real-time

  • Proteomics to quantify UbiA protein levels during adaptation

  • Metabolomics to track ubiquinone production under stress conditions

These approaches would provide valuable insights into how B. cenocepacia regulates this essential metabolic pathway during host adaptation and stress response.

What novel methodologies can advance research on B. cenocepacia UbiA?

Emerging technologies offer exciting opportunities to advance our understanding of B. cenocepacia UbiA:

Cutting-Edge Methodologies:

  • Cryo-EM for Membrane Protein Structures:

    • Application: Determination of UbiA structure in native-like lipid environments

    • Advantage: Visualizes the protein in a more physiologically relevant state

    • Innovation: Lipid nanodisc reconstitution combined with high-resolution cryo-EM

  • Nanobody Development:

    • Application: Generation of camelid antibody fragments that stabilize UbiA conformations

    • Advantage: Enables crystallization of difficult membrane proteins

    • Innovation: Yeast display libraries for rapid nanobody selection

  • Native Mass Spectrometry:

    • Application: Analysis of UbiA-substrate complexes and protein-protein interactions

    • Advantage: Preserves non-covalent interactions during analysis

    • Innovation: Modified ionization methods for membrane protein complexes

  • Time-Resolved Enzyme Kinetics:

    • Application: Measuring individual steps in the UbiA catalytic cycle

    • Advantage: Identifies rate-limiting steps for targeted inhibition

    • Innovation: Microfluidic mixing devices coupled with spectroscopic detection

Integration with B. cenocepacia Research:
These methodologies can be particularly valuable when studying B. cenocepacia adaptation to different environments. For example, analyzing UbiA structure and function from bacteria adapted to onion tissue versus those adapted to human lung conditions could reveal environment-specific modifications that influence enzyme function.

How could CRISPR-Cas9 technologies advance functional studies of UbiA in B. cenocepacia?

CRISPR-Cas9 gene editing offers transformative approaches for studying UbiA function in B. cenocepacia:

Genetic Manipulation Strategies:

  • Precise Genomic Modifications:

    • Creating point mutations in catalytic residues to assess structure-function relationships

    • Introducing regulatory element modifications to study expression control

    • Generating conditional knockdowns to study essentiality in different conditions

  • Domain Swapping Experiments:

    • Replacing B. cenocepacia UbiA domains with those from other species

    • Creating chimeric enzymes to identify host-specific adaptations

    • Engineering substrate specificity alterations

  • Regulatory Network Analysis:

    • CRISPRi for partial repression to identify genetic interactions

    • CRISPR activation to upregulate expression and assess metabolic consequences

    • Multiplex targeting to study redundancy in prenylation pathways

Implementation Challenges and Solutions:

ChallengeSolutionMethodology
Delivery into B. cenocepaciaConjugation-based methodsFour-parental conjugation with TMP resistance markers
Off-target effectsHigh-fidelity Cas9 variantsEngineered SpCas9-HF or eSpCas9 with reduced off-target activity
Homology-directed repair efficiencyOptimized donor template designIncorporation of selection markers flanked by FRT sites for subsequent removal
Verification of editsDeep sequencing validationTargeted amplicon sequencing to confirm precise modifications

Research Applications:
CRISPR-based approaches could be particularly valuable for studying B. cenocepacia adaptation to different environments, such as the experimental evolution demonstrated in onion tissue . By creating specific UbiA variants and testing their function in different host environments, researchers could elucidate the role of ubiquinone biosynthesis in host adaptation and virulence.

What are the most promising future research directions for B. cenocepacia UbiA?

The study of B. cenocepacia UbiA intersects with several cutting-edge research areas that hold significant potential:

These research directions build upon our understanding of B. cenocepacia as an adaptable pathogen that can thrive in diverse environments from soil to human lungs , with UbiA serving as a critical enzyme at the intersection of energy metabolism and cellular homeostasis.

How might understanding UbiA contribute to broader knowledge of bacterial adaptation and pathogenesis?

Research on B. cenocepacia UbiA has implications that extend far beyond this specific enzyme and organism:

Broader Scientific Impact:

  • Metabolic Adaptation Principles:

    • UbiA studies reveal how core metabolism adapts to host environments

    • Insights into how bacteria balance energetic requirements during host switching

    • Understanding of metabolic bottlenecks that could represent universal therapeutic targets

  • Evolution of Pathogenesis:

    • B. cenocepacia's transition from environmental bacterium to human pathogen provides a model for studying pathogen emergence

    • The role of ubiquinone biosynthesis in this transition illuminates metabolic prerequisites for pathogenicity

    • Comparison with other emerging pathogens may reveal common metabolic adaptations

  • Drug Discovery Paradigms:

    • Targeting essential metabolic enzymes represents an alternative to conventional antibiotic targets

    • Lessons from UbiA inhibitor development inform approaches to other challenging bacterial targets

    • Cross-species differences in ubiquinone biosynthesis enable selective therapeutic targeting

  • One Health Applications:

    • Understanding UbiA's role across plant, animal, and human hosts connects agricultural and medical microbiology

    • Knowledge of how B. cenocepacia adapts to different hosts informs prevention strategies

    • Ecological insights may help predict and prevent emergence of new pathogenic strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.