Recombinant Burkholderia cenocepacia Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB; Bcen2424_1021; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
dsbB
Target Protein Sequence
MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFL AAGIRNWRGVWVLELLIAIAAAGGVGTAARHLSIQMNPGFSCGFDTLQPIVDSLPPAQWF PGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVASLWRHRRKLAS
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the DsbA-DsbB disulfide bond formation system in Burkholderia cenocepacia?

The DsbA-DsbB system in B. cenocepacia is composed of two key components: DsbA, a periplasmic disulfide bond oxidoreductase, and DsbB, a membrane-bound disulfide bond oxidoreductase. This system plays a critical role in the proper folding of various proteins by catalyzing the formation of disulfide bonds between cysteine residues. In B. cenocepacia, DsbA contains a redox-active site with the sequence Cys-Pro-His-Cys that is homologous to Escherichia coli DsbA . The system functions as an electron transport chain, where DsbA directly oxidizes substrate proteins and is then reoxidized by DsbB, which subsequently transfers electrons to the respiratory chain .

What phenotypes are affected by the DsbA-DsbB system in B. cenocepacia?

The DsbA-DsbB system influences multiple phenotypes in B. cenocepacia. Mutation studies in both dsbA and dsbB genes have demonstrated that this system is essential for:

  • Production of extracellular protease

  • Production of alkaline phosphatase

  • Bacterial motility

  • Resistance to heavy metals (particularly Cd²⁺ and Zn²⁺)

  • Multi-drug resistance (including β-lactams, kanamycin, erythromycin, novobiocin, ofloxacin, and sodium dodecyl sulfate)

These phenotypic impacts highlight the importance of proper disulfide bond formation in various cellular processes and virulence mechanisms of this pathogen.

How can researchers generate and validate dsbB mutants in B. cenocepacia?

To generate dsbB mutants in B. cenocepacia, researchers can employ transposon mutagenesis, a technique that has been successfully used for both dsbA and dsbB genes. The procedure involves:

  • Selection of an appropriate transposon delivery vector compatible with B. cenocepacia

  • Transformation of the vector into B. cenocepacia and selection of transposon insertion mutants

  • Screening for phenotypic changes associated with DsbB deficiency (reduced protease activity, decreased motility)

  • Confirmation of the transposon insertion site through PCR and sequencing

Validation of the mutants can be performed by complementation studies using a wild-type copy of the dsbB gene on a plasmid vector. Successful complementation should restore the wild-type phenotypes, confirming that the observed effects are due to the disruption of the dsbB gene rather than polar effects or secondary mutations .

What methodological approaches can be used to assess the function of recombinant DsbB protein?

Functional assessment of recombinant DsbB protein can be conducted through several complementary approaches:

  • Protease Activity Assay: Measuring extracellular protease activity using casein or gelatin as substrates can assess one of the primary phenotypes affected by DsbB function.

  • Motility Assays: Swimming and swarming motility can be evaluated using semi-solid agar plates, comparing the wild-type, mutant, and complemented strains.

  • Antibiotic Susceptibility Testing: Determining minimum inhibitory concentrations (MICs) for various antibiotics can evaluate the role of DsbB in multi-drug resistance.

  • Metal Resistance Assays: Growth inhibition tests with varying concentrations of Cd²⁺ and Zn²⁺ can assess the role of DsbB in metal resistance.

  • Protein Oxidation State Analysis: Using alkylating agents that react with free thiols, researchers can assess the oxidation state of periplasmic proteins in wild-type and dsbB mutant strains.

These methodologies provide a comprehensive evaluation of DsbB functionality and its impact on various cellular processes .

How does the redox activity of DsbB in B. cenocepacia compare to homologous systems in other bacteria?

The DsbB protein in B. cenocepacia functions as part of the DsbA-DsbB disulfide bond formation system, which has homologs in various bacteria including E. coli. While the core function of electron transfer is conserved, there are significant differences in substrate specificity and regulatory mechanisms.

An important distinction is the apparent integration of the DsbA-DsbB system with other signaling networks in B. cenocepacia, including potential connections to the BDSF quorum sensing system and possibly the c-di-GMP signaling pathway, which are crucial for virulence and biofilm formation . This suggests a more complex regulatory network in B. cenocepacia compared to model organisms like E. coli.

What specific substrates of the DsbA-DsbB system are critical for B. cenocepacia virulence?

While the complete substrate profile of the DsbA-DsbB system in B. cenocepacia is not fully characterized, evidence suggests several key substrates that are critical for virulence:

  • Metalloproteases: ZmpA, a wide-spectrum metalloprotease found in Burkholderia species, is a known DsbA substrate that likely requires DsbB for proper folding. ZmpA is thought to cause tissue damage during infection .

  • Motility Factors: Components of the flagellar system require proper disulfide bond formation, as demonstrated by the reduced motility of dsbA and dsbB mutants .

  • Components of Efflux Systems: The increased sensitivity of dsbB mutants to antibiotics and heavy metals suggests that components of efflux pumps are substrates of the DsbA-DsbB system .

  • Sulfatase-like Hydrolase Transferases: These enzymes, identified as DsbA substrates in related Burkholderia species, may play roles in modifying host cell components during infection .

These substrates represent potential targets for therapeutic intervention, as disrupting their proper folding could attenuate virulence without directly targeting essential bacterial processes.

How does the DsbA-DsbB system contribute to B. cenocepacia pathogenesis in cystic fibrosis patients?

The DsbA-DsbB system contributes to B. cenocepacia pathogenesis through multiple mechanisms that enhance bacterial survival and virulence in the CF lung environment:

  • Protease Production: The system is essential for the production of functional extracellular proteases, including potentially ZmpA, which can damage host tissues and disrupt immune responses .

  • Biofilm Formation: While not directly tested for DsbB, proper protein folding is critical for the production of biofilm matrix components. B. cenocepacia biofilms contribute to persistence in the CF lung and resistance to antibiotics and host defenses .

  • Multi-drug Resistance: The DsbA-DsbB system contributes to antibiotic resistance mechanisms, which is particularly relevant in CF patients who undergo frequent antibiotic treatments. Mutation in the DsbA-DsbB system results in increased sensitivity to multiple antibiotics including β-lactams, kanamycin, erythromycin, novobiocin, and ofloxacin .

  • Metal Homeostasis: The increased sensitivity of dsbB mutants to metals like Cd²⁺ and Zn²⁺ suggests a role in metal efflux or detoxification systems, which may be important for survival in the metal-rich environment of the CF lung .

  • Motility: The system is required for proper motility, which may facilitate initial colonization and spread within the lungs .

These mechanisms collectively enhance the pathogen's ability to establish and maintain chronic infections in CF patients, contributing to lung damage and disease progression.

What is the relationship between the DsbA-DsbB system and interspecies competition in polymicrobial infections?

In polymicrobial infection settings, the DsbA-DsbB system may play roles beyond basic bacterial physiology, contributing to interspecies competition and ecological fitness:

  • Influence on Signaling Molecules: B. cenocepacia produces cis-2-dodecenoic acid (BDSF), a signaling molecule structurally similar to the diffusible signal factor (DSF) from Xanthomonas campestris. While the direct connection between the DsbA-DsbB system and BDSF production hasn't been established, proper protein folding may be required for the functionality of enzymes involved in BDSF synthesis or detection .

  • Antagonism Against Fungi: B. cenocepacia coculture or addition of BDSF strongly inhibits Candida albicans germ tube formation, representing an antagonistic interaction between these two human pathogens that often co-occur in CF patients . The DsbA-DsbB system might be important for the production of functional components in this antagonistic mechanism.

  • Competitive Advantage Through Proteases: Properly folded extracellular proteases dependent on the DsbA-DsbB system may degrade proteins produced by competing microorganisms or modify the shared environment to favor B. cenocepacia growth .

Understanding these interspecies dynamics is crucial for developing strategies to manage polymicrobial infections, especially in chronic conditions like CF where multiple pathogens may coexist and interact.

How does the DsbA-DsbB system interact with the BDSF quorum sensing system in B. cenocepacia?

While direct experimental evidence connecting the DsbA-DsbB and BDSF systems is limited in the provided search results, several potential interactions can be inferred:

  • Shared Phenotypic Controls: Both systems influence overlapping phenotypes including biofilm formation, motility, and virulence factors. The BDSF system works through RpfR to regulate c-di-GMP levels, while the DsbA-DsbB system ensures proper folding of proteins involved in these processes .

  • Potential Protein Folding Requirements: The functionality of key components in the BDSF signaling pathway, such as the RpfR protein (which contains GGDEF and EAL domains for c-di-GMP metabolism), may depend on proper disulfide bond formation mediated by the DsbA-DsbB system .

  • Coordinated Regulation: Both systems may be coordinated to respond to different environmental cues - BDSF responding to population density and the DsbA-DsbB system potentially responding to redox conditions in the periplasm.

These potential interactions suggest a complex regulatory network where proper protein folding through the DsbA-DsbB system may be a prerequisite for normal BDSF signaling, and disruptions in either system could have cascading effects on cellular functions and virulence.

What is the relationship between DsbB function and cyclic-di-GMP signaling in B. cenocepacia?

The relationship between DsbB function and cyclic-di-GMP (c-di-GMP) signaling represents an intriguing area of potential crosstalk between different regulatory systems:

  • Structural Requirements for c-di-GMP Proteins: B. cenocepacia contains 25 putative c-di-GMP metabolizing proteins, including RpfR, which has been identified as a key regulator affecting biofilm formation, motility, and virulence . The proper folding and function of these proteins, particularly those containing multiple cysteine residues, may depend on the DsbA-DsbB system.

  • Overlapping Phenotypic Control: Both systems regulate similar phenotypes:

    • Motility is negatively regulated by c-di-GMP and requires functional DsbA-DsbB

    • Biofilm and matrix production are positively regulated by c-di-GMP, while some components may require proper disulfide bond formation

    • Virulence factors are regulated by both systems

  • Potential Signaling Cascade: The observations that Bcal2449 (a c-di-GMP metabolizing protein) regulates virulence and that decreased c-di-GMP levels are required for virulence suggest a possible cascade where properly folded proteins (dependent on DsbA-DsbB) influence c-di-GMP levels, which in turn regulate virulence .

This relationship suggests that the DsbA-DsbB system may function as a foundational layer ensuring the proper structure and function of proteins involved in the more dynamic c-di-GMP signaling network, creating a hierarchical regulatory system that responds to both redox conditions and other environmental signals.

What are the optimal expression systems and conditions for producing functional recombinant B. cenocepacia DsbB?

For successful production of functional recombinant B. cenocepacia DsbB, researchers should consider these specific technical parameters:

  • Expression System Selection:

    • For structural studies: E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • For functional studies: Non-pathogenic Burkholderia strains or related Proteobacteria to ensure proper membrane insertion and folding

  • Expression Vector Design:

    • Include a carefully designed signal sequence to ensure proper membrane targeting

    • Consider using inducible promoters (e.g., PBAD or Ptac) for controlled expression levels

    • Incorporate affinity tags (His-tag or Strep-tag) positioned to avoid interference with membrane topology

  • Optimal Growth and Induction Conditions:

    • Growth temperature: Lower temperatures (16-25°C) are likely optimal to prevent inclusion body formation

    • Induction timing: Mid-log phase (OD600 0.4-0.6)

    • Inducer concentration: Low inducer concentrations for slow, proper folding

    • Media composition: Rich media supplemented with appropriate cofactors for proper folding

  • Membrane Fraction Isolation:

    • Gentle lysis methods to preserve native membrane structure

    • Differential centrifugation to isolate membrane fractions

    • Detergent selection is critical: mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are recommended

The success of recombinant DsbB production should be validated through activity assays measuring its ability to reoxidize DsbA or directly through assessment of phenotype complementation in dsbB-deficient strains.

What analytical methods are most effective for characterizing the structure-function relationship of recombinant DsbB?

To thoroughly characterize the structure-function relationship of recombinant B. cenocepacia DsbB, researchers should employ multiple complementary analytical approaches:

  • Structural Analysis:

    • Cryo-electron microscopy for membrane protein structure determination

    • Circular dichroism spectroscopy to assess secondary structure content and stability

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) to probe specific regions

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and interaction interfaces

  • Functional Analysis:

    • In vitro reconstitution of electron transfer from DsbA to DsbB using purified components

    • Redox potential measurements of key cysteine residues using thiol-reactive probes

    • Kinetic analysis of DsbB-mediated DsbA reoxidation under varying conditions

    • Site-directed mutagenesis of conserved residues to identify catalytic sites

  • Interaction Analysis:

    • Pull-down assays to identify protein-protein interactions

    • Microscale thermophoresis to measure binding affinities

    • Crosslinking studies to capture transient interactions

    • In vivo bacterial two-hybrid systems adapted for membrane proteins

  • Complementation Studies:

    • Phenotypic rescue experiments in dsbB mutants using wild-type or mutant variants

    • Quantitative assessment of restored phenotypes (protease activity, motility, antibiotic resistance)

By combining these approaches, researchers can establish connections between specific structural features of DsbB and its functional roles in maintaining bacterial physiology and virulence.

How does disruption of the DsbB system affect antibiotic susceptibility profiles in B. cenocepacia?

Disruption of the DsbB system significantly alters antibiotic susceptibility in B. cenocepacia, creating a comprehensive vulnerability across multiple drug classes. The following table summarizes the changes in antibiotic susceptibility profiles:

Antibiotic ClassRepresentative DrugsSusceptibility Change in dsbB MutantsProposed Mechanism
β-lactamsPenicillins, CephalosporinsIncreased susceptibilityImpaired folding of β-lactamases and efflux pumps
AminoglycosidesKanamycinIncreased susceptibilityCompromised membrane integrity and efflux systems
MacrolidesErythromycinIncreased susceptibilityDefective multidrug efflux pumps requiring disulfide bonds
QuinolonesOfloxacinIncreased susceptibilityImpaired topoisomerase protection mechanisms and efflux
DNA Synthesis InhibitorsNovobiocinIncreased susceptibilityAltered cell envelope permeability
DetergentsSodium Dodecyl SulfateIncreased susceptibilityCompromised cell envelope integrity

This multifaceted vulnerability suggests that the DsbA-DsbB system is central to various resistance mechanisms in B. cenocepacia, making it a potential target for adjuvant therapies that could restore antibiotic efficacy in resistant strains.

Can DsbB inhibitors be developed as potential adjuvants to enhance antibiotic efficacy against B. cenocepacia?

The development of DsbB inhibitors as antibiotic adjuvants presents a promising strategy for combating B. cenocepacia infections, particularly in cystic fibrosis patients where antibiotic resistance is prevalent:

  • Rational Design Approaches:

    • Targeting the quinone binding site of DsbB, which is essential for electron transfer

    • Developing peptidomimetics that compete with DsbA binding

    • Designing small molecules that disrupt critical disulfide bonds within DsbB itself

  • Expected Benefits:

    • Resensitization to multiple antibiotic classes simultaneously

    • Attenuation of virulence without direct bactericidal pressure

    • Reduction in biofilm formation and persistence

    • Potential synergy with host immune defenses

  • Potential Challenges:

    • Achieving selectivity for bacterial DsbB over human disulfide bond-forming enzymes

    • Ensuring penetration through the B. cenocepacia cell envelope

    • Managing potential toxicity of compounds that interfere with redox biochemistry

    • Addressing potential compensatory mechanisms

  • Experimental Validation Approaches:

    • High-throughput screening against purified DsbB protein

    • Secondary screening in dsbB complementation systems

    • Checkerboard assays to quantify synergy with various antibiotics

    • Testing efficacy in biofilm disruption and in infection models

Given the central role of the DsbA-DsbB system in maintaining multiple antibiotic resistance mechanisms, inhibitors of this system could potentially serve as broad-spectrum adjuvants that restore effectiveness to multiple antibiotic classes simultaneously .

What are the critical unresolved questions regarding B. cenocepacia DsbB function?

Despite significant advances in understanding B. cenocepacia DsbB, several critical knowledge gaps remain:

  • Complete Substrate Profile: While we know DsbB is involved in multiple phenotypes, the specific substrate proteins requiring DsbB-dependent disulfide bond formation for proper function remain largely unidentified. A systematic proteomics approach comparing wild-type and dsbB mutant periplasmic protein oxidation states would address this gap .

  • Structural Characterization: The detailed molecular structure of B. cenocepacia DsbB and how it might differ from well-characterized homologs like E. coli DsbB remains unknown. Structural studies would facilitate rational drug design efforts.

  • Regulatory Networks: The integration of the DsbA-DsbB system with other regulatory networks like BDSF quorum sensing and c-di-GMP signaling requires further investigation to understand the hierarchical control of virulence and persistence .

  • Host-Pathogen Interactions: How DsbB-dependent processes specifically contribute to survival within the host, particularly in the CF lung environment, is not fully characterized.

  • In vivo Significance: The relative importance of DsbB for infection establishment versus persistence in chronic infections needs clarification through appropriate animal models.

Addressing these knowledge gaps would significantly advance our understanding of this important bacterial virulence system and potentially lead to novel therapeutic approaches.

What emerging methodologies could advance research on recombinant DsbB and its applications?

Several emerging methodologies offer promising avenues for advancing research on recombinant DsbB:

  • Cryo-Electron Microscopy: Recent advances in cryo-EM for membrane proteins could enable determination of DsbB structure in its native lipid environment, providing insights into its mechanism and potential for drug targeting.

  • Nanodiscs and Lipid Cubic Phase Technologies: These systems allow for the study of membrane proteins in more native-like environments, potentially revealing functionally relevant conformational states of DsbB.

  • CRISPR-Interference Approaches: CRISPRi technology could enable tunable repression of dsbB expression, allowing for the study of partial loss-of-function phenotypes and dose-dependent effects.

  • Advanced Bioinformatics: Machine learning approaches could predict DsbB substrates based on patterns of cysteine distribution and structural features, guiding targeted experimental validation.

  • In vivo Redox Sensors: Genetically encoded fluorescent redox sensors could enable real-time monitoring of DsbB activity in living bacteria during infection or antibiotic treatment.

  • Single-Cell Techniques: Methods like single-cell RNA-seq could reveal population heterogeneity in DsbB-dependent phenotypes, potentially explaining persistence or resistance phenomena.

  • Organoid Models: Advanced CF lung organoid models could provide more relevant platforms for studying DsbB's role in host-pathogen interactions specific to the CF lung environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.