Recombinant Burkholderia cenocepacia Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia cenocepacia Large-conductance Mechanosensitive Channel (MscL)

The Large-conductance Mechanosensitive Channel (MscL) is a crucial membrane protein found in various bacteria, including Burkholderia cenocepacia. This channel plays a vital role in maintaining cellular integrity by acting as an osmotic release valve during osmotic shock, preventing cell lysis by releasing excess ions and water from the cell . While specific research on the recombinant Burkholderia cenocepacia MscL is limited, understanding its structure and function can provide insights into potential therapeutic targets for managing B. cenocepacia infections, particularly in cystic fibrosis patients.

Structure and Function of MscL

MscL channels are typically pentameric, consisting of five identical subunits, each with two transmembrane helices (M1 and M2) . The channel opens in response to mechanical stress in the lipid bilayer, such as osmotic shock, allowing the passage of ions and small molecules to prevent cell lysis . The pore diameter of MscL in its open state is approximately 3 nm, allowing the passage of small proteins up to 9 kDa .

Potential Therapeutic Applications

The MscL channel's role in bacterial survival under stress conditions makes it an attractive target for developing new antimicrobial strategies. By inhibiting MscL, it may be possible to increase the susceptibility of B. cenocepacia to osmotic stress, potentially enhancing the effectiveness of existing treatments .

Research Findings and Data

While specific data on recombinant Burkholderia cenocepacia MscL is not readily available, studies on MscL in other bacteria highlight its potential as a therapeutic target. For example, research on Escherichia coli MscL has demonstrated its importance in bacterial survival under osmotic stress .

Bacterial SpeciesMscL FunctionPotential Therapeutic Use
Escherichia coliOsmotic release valveTarget for antimicrobial drugs
Mycobacterium tuberculosisCell survival under stressPotential target for TB treatments
Burkholderia cenocepaciaHypothetical role in stress responsePotential target for managing CF infections

Challenges and Future Directions

Developing therapeutic strategies targeting MscL in B. cenocepacia requires further research into its specific structure, function, and role in bacterial pathogenesis. Additionally, understanding how MscL interacts with other stress response mechanisms in B. cenocepacia could provide insights into novel therapeutic approaches.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Bcen2424_1951; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
mscL
Target Protein Sequence
MSIIKEFKEFAVKGNVMDLAVGVIIGGAFSKIVDSVVKDLIMPVIGVLTGGLDFSNKFVL LGTIPPSFKGNPDSFKDLQAAGVAAFGYGSFITVAINFVILAFIIFLMVKFINKLRKPEE AAPAATPEDVVLLREIRDSLKQR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

Advanced Research Questions

  • What are the optimal purification and storage conditions for recombinant B. cenocepacia mscL?

    Purification of recombinant B. cenocepacia mscL requires specialized approaches due to its membrane protein nature. Based on established protocols, the following methodology is recommended:

    1. Membrane Extraction: Following bacterial lysis, membrane fractions should be isolated by ultracentrifugation and solubilized using appropriate detergents (typically n-dodecyl-β-D-maltoside or lauryldimethylamine oxide).

    2. Affinity Purification: His-tagged mscL can be purified using nickel affinity chromatography with imidazole gradient elution under detergent-containing conditions.

    3. Buffer Optimization: Optimal storage buffer comprises Tris/PBS-based buffer with 6% trehalose at pH 8.0, which maintains protein stability .

    4. Storage Recommendations:

      • Lyophilized protein should be briefly centrifuged before opening

      • Reconstitute to 0.1-1.0 mg/mL in deionized sterile water

      • Add glycerol to 50% final concentration for long-term storage

      • Aliquot to avoid repeated freeze-thaw cycles

      • Store working aliquots at 4°C for up to one week

      • Store long-term stocks at -20°C/-80°C

    Purity of >90% as determined by SDS-PAGE is typically achievable with these methods.

  • How can functional assays be designed to characterize B. cenocepacia mscL activity?

    Functional characterization of B. cenocepacia mscL requires specialized techniques that assess mechanosensitive channel properties. Several methodological approaches can be employed:

    1. Electrophysiological Analysis:

      • Patch-clamp recordings of giant E. coli spheroplasts expressing recombinant mscL

      • Reconstitution into artificial liposomes for planar lipid bilayer recordings

      • Measurement of single-channel conductance and tension threshold for activation

    2. Fluorescence-Based Assays:

      • Liposome-encapsulated fluorescent dye release assays

      • Changes in fluorescence intensity correlate with channel opening upon hypoosmotic shock

      • Real-time monitoring of channel activity in response to controlled membrane tension

    3. Cellular Survival Assays:

      • Complementation of mscL-deficient bacterial strains with B. cenocepacia mscL

      • Assessment of survival following osmotic downshock

      • Comparison with wild-type and known mutant controls

    4. Structural Dynamics:

      • Site-directed spin labeling combined with electron paramagnetic resonance

      • Monitoring conformational changes during channel gating

      • Correlation of structural dynamics with channel function

    These methodologies provide complementary information about channel properties, allowing comprehensive functional characterization of B. cenocepacia mscL.

  • What role might mscL play in B. cenocepacia's resistance to antimicrobial therapies?

    B. cenocepacia exhibits remarkable intrinsic resistance to antibiotics, making infections extremely difficult to treat. The mscL protein may contribute to antimicrobial resistance through several mechanisms:

    1. Membrane Stress Response: Certain antibiotics that target cell membranes or cell wall synthesis create mechanical stress on bacterial membranes. mscL activation may serve as a protective response to this stress, potentially reducing antibiotic efficacy .

    2. Persister Cell Formation: Mechanosensitive channels have been implicated in bacterial persistence - a phenotypic state of dormancy associated with antibiotic tolerance. B. cenocepacia's ability to form persister cells may be partially dependent on mscL function.

    3. Membrane Permeability Regulation: By controlling membrane tension and permeability, mscL may influence the uptake of antibiotics, particularly hydrophilic compounds that require specific membrane transporters.

    4. Stress Response Integration: Research has shown that B. cenocepacia utilizes sophisticated regulatory networks to coordinate stress responses. The mscL protein might be integrated into these networks, contributing to the bacterium's ability to survive antibiotic treatment .

    Understanding these mechanisms could potentially identify new therapeutic strategies targeting mscL function as an adjunct to conventional antibiotic therapy.

  • How might the B. cenocepacia mscL contribute to bacterial adaptation during infection progression?

    The progression of B. cenocepacia infection in CF lungs involves multiple stages, each presenting distinct environmental challenges that may involve mscL function:

    1. Initial Colonization: During early colonization, bacteria encounter the unique osmotic environment of CF airways, characterized by dehydrated, viscous mucus. mscL may help bacteria adjust to these conditions through osmoregulation.

    2. Biofilm Formation: B. cenocepacia forms biofilms in CF lungs, and the transition to biofilm lifestyle involves significant physiological changes. Mechanosensitive channels may respond to the mechanical stresses within biofilm structures and contribute to the coordination of biofilm formation.

    3. Cellular Invasion: B. cenocepacia can invade and survive within epithelial cells and macrophages . This intracellular phase involves passage through membrane-bound compartments with varying osmotic properties. mscL likely helps maintain bacterial integrity during these transitions.

    4. Cepacia Syndrome Development: The rapid decline in some patients known as "cepacia syndrome" involves bacterial dissemination and severe inflammation. The ability of B. cenocepacia to adapt to various host environments during dissemination may depend partly on mechanosensitive responses.

    Studies examining mscL expression patterns during different infection stages could provide valuable insights into its role in pathogenesis.

  • What approaches can be used to study the relationship between mscL and other virulence factors in B. cenocepacia?

    Understanding how mscL interacts with other virulence mechanisms requires integrated experimental approaches:

    1. Transcriptomic Analysis: RNA-sequencing studies comparing wild-type and mscL-deficient strains under various conditions can reveal co-regulated virulence factors . This approach identifies genes whose expression changes in response to mscL deletion.

    2. Protein-Protein Interaction Studies:

      • Bacterial two-hybrid systems

      • Co-immunoprecipitation followed by mass spectrometry

      • Membrane protein cross-linking techniques
        These methods can identify direct protein partners of mscL that might influence virulence.

    3. Genetic Interaction Mapping:

      • Construction of double mutants (mscL plus other virulence genes)

      • Synthetic genetic array analysis

      • Suppressor screens to identify compensatory mutations
        These approaches reveal functional relationships between mscL and other bacterial systems.

    4. Infection Models with Reporter Systems:

      • In vitro cell culture infection models using fluorescent reporters

      • Animal models with bioluminescent strains

      • Real-time monitoring of bacterial gene expression during infection

    Recent studies have demonstrated that B. cenocepacia employs sophisticated systems like the Type VI Secretion System (T6SS) for bacterial competition and host interaction . Investigating potential connections between mechanosensing through mscL and regulation of secretion systems could reveal important virulence mechanisms.

  • How can site-directed mutagenesis be applied to study critical residues in B. cenocepacia mscL?

    Site-directed mutagenesis represents a powerful approach to understand structure-function relationships in B. cenocepacia mscL. Based on the protein sequence information available, several targeted approaches can be implemented :

    1. Conserved Residue Analysis:

      • Alignment of B. cenocepacia mscL with well-characterized homologs

      • Identification of highly conserved amino acids across bacterial species

      • Systematic alanine scanning of these residues to determine essential positions

    2. Tension Sensor Domain Modification:

      • Mutation of hydrophobic residues at membrane interfaces

      • Alteration of channel gating threshold through specific substitutions

      • Testing phenotypic consequences of altered tension sensitivity

    3. Channel Pore Residue Engineering:

      • Modification of pore-lining residues (identified through homology modeling)

      • Assessment of changes in ion conductance, selectivity, and gating kinetics

      • Creation of gain-of-function or dominant-negative mutants

    4. Multiparameter Mutation Analysis:

      Mutation TargetExpected EffectFunctional Assay
      Transmembrane helicesAltered channel gatingPatch-clamp electrophysiology
      Cytoplasmic domainsModified protein interactionsProtein binding assays
      C-terminal regionChanged regulationStress response studies
      Conserved glycine residuesRestricted conformational changesChannel kinetics analysis
    5. Reporter Tag Introduction:

      • Strategic placement of fluorescent protein fusions or specific tags

      • Real-time visualization of protein localization during osmotic challenges

      • Monitoring of conformational changes during channel gating

    The combination of these mutagenesis approaches with functional assays provides a comprehensive understanding of the molecular mechanisms underlying B. cenocepacia mscL function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.