Recombinant Burkholderia cenocepacia Lipase chaperone (lifO)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipase Activation

LifO acts as a chaperone for lipases by:

  • Stabilizing the Lipase Structure: Prevents aggregation during folding .

  • Enabling Enzymatic Activity: Lipases remain inactive without LifO-mediated folding .

  • Forming a Complex: LifO binds transiently to lipases during secretion, ensuring correct conformational changes .

Mechanistic Insights

  • In vitro Activation: Denatured lipases regain activity only when renatured in the presence of LifO .

  • Genetic Dependency: lifO is co-expressed with lipase genes (e.g., lipA) in operons .

Production and Purification

Recombinant LifO is synthesized using heterologous systems:

Expression Systems

SystemYield and Notes
E. coliHigh yield (~0.1 mg/mL); His-tagged variants simplify purification
Cell-Free ExpressionAvoids host toxicity; suitable for structural studies

Purification Protocol

  1. Lysis: Tris-based buffer (pH 8.0) with NaCl and detergent (e.g., 0.6% DDM) .

  2. Chromatography: Immobilized metal affinity chromatography (IMAC) for His-tagged variants .

  3. Storage: Stabilized in 50% glycerol at -20°C to -80°C .

Applications in Biotechnology

LifO has utility in:

  • Industrial Lipase Production: Enhances lipase yields for detergent, biofuel, and pharmaceutical industries .

  • Drug Development: Facilitates studies on Burkholderia pathogenicity, as lipases contribute to virulence in cystic fibrosis infections .

  • Enzyme Engineering: Used to optimize lipase thermostability and substrate specificity .

Comparative Analysis of LifO Variants

LifO orthologs exist across Burkholderia species with structural variations:

SpeciesGene NameKey Differences
B. cenocepacialifO344 residues; associated with ET12 lineage virulence
B. cepacialifO344 residues; 98% sequence identity to B. cenocepacia
Xylella fastidiosaXfasM23_0463Divergent C-terminal domain

Research Challenges

  • Structural Dynamics: The LifO-lipase interaction interface remains unresolved .

  • Host Compatibility: Mammalian systems show lower yields compared to E. coli .

Future Directions

  • CRISPR-Based Engineering: Modifying lifO to enhance lipase activity in industrial strains .

  • Therapeutic Targeting: Inhibiting LifO to disrupt Burkholderia infections in cystic fibrosis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lifO; Bcen2424_3916; Lipase chaperone; Lipase activator protein; Lipase foldase; Lipase helper protein; Lipase modulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
lifO
Target Protein Sequence
MAAREGRAPLARRAAIYGVVGLAAIAGVAMWSGAGPHRGTGAAGDAPDAAAVGGVAAAAP QAAVPASAGLPPSLAGSSAPRLPLDAGGHLAKSRAVRDFFDYCLTARSDLSAAALDALVV REIAAQLDGTVAQVEALDVWHRYRAYLDALATLRDAGAVDKSDLGALQLALDQRASIAYR TLGDWSQPFFGAEQWRQRYDLARLKITQDRSLTDAQKAERLAALQQQMPADERAAQQRVD RQRAAIDQIAQLQKSGATPDAMRAQLTQTLGPEAAARVAQMQQDDASWQSRYADYAAQRA QIESAGLSPQDRDAQIAALRQRVFTKPGEAVRAASLDRGAGSAH
Uniprot No.

Target Background

Function
May be involved in the folding of the extracellular lipase during its passage through the periplasm.
Database Links
Protein Families
Lipase chaperone family
Subcellular Location
Cell inner membrane; Single-pass membrane protein; Periplasmic side.

Q&A

What is Burkholderia cenocepacia Lipase chaperone (lifO) and what is its primary function in bacterial systems?

Lipase chaperone (lifO) is a specialized protein essential for the proper folding and activation of lipases in Burkholderia cenocepacia (formerly classified as Pseudomonas cepacia). The chaperone functions as a lipase activator protein, foldase, helper protein, and modulator that ensures the correct folding of the lipase enzyme into its active conformation . In bacterial systems, the lipase is initially expressed in an inactive form, and the chaperone is required for proper folding into its catalytically active state. This system represents a specialized protein quality control mechanism evolved specifically for lipase biogenesis.

When studying this system, it's important to note that at least one chaperone molecule is needed for the correct folding of one lipase molecule, as the chaperone acts noncatalytically toward the lipase . This stoichiometric relationship is critical for experimental design when working with recombinant systems.

What are the optimal expression systems for recombinant production of Burkholderia cenocepacia Lipase chaperone?

Several expression systems have been evaluated for the recombinant production of Burkholderia cenocepacia Lipase chaperone, each with specific advantages depending on research requirements:

For most research applications, modified E. coli expression systems using synthetic gene fragments to replace the high-GC 5' region and/or truncated versions lacking the N-terminal membrane anchor have proven most effective. This approach has yielded expression levels up to 60% of total cellular protein . When designing expression constructs, researchers should consider codon optimization for the host organism and the addition of purification tags that will not interfere with chaperone function.

How can the expression of functional Lipase chaperone be optimized in E. coli systems?

Optimization of functional Lipase chaperone expression in E. coli requires addressing several critical factors:

  • Gene sequence modification: Replace the high GC content 5' region with a synthetic fragment optimized for E. coli codon usage .

  • N-terminal modifications: Deletion of the putative membrane anchor by removing the first 34 or 70 N-terminal amino acids significantly improves expression. These truncated versions (Δ34 or Δ70) have shown expression levels up to 60% of total cellular protein .

  • Vector selection: Strong, inducible promoters such as the temperature-inducible λP RL promoter in pCYTEXP1 have proven effective .

  • Signal sequence fusion: Addition of OmpA signal sequence can direct the expression pathway, though processing may be incomplete .

  • Purification tag placement: Addition of His-tags facilitates purification without compromising function when properly positioned .

The experimental approach should be tailored to the specific research requirements. For example, when maximum yield is the priority, the Δ70 truncated version with a His-tag has demonstrated superior results, while applications requiring membrane association might benefit from less extensive truncations.

What methodologies are most effective for the refolding of recombinant lipase using the Lipase chaperone?

Refolding of recombinant lipase requires carefully optimized protocols that incorporate the purified Lipase chaperone. The methodology that has demonstrated the highest success includes the following critical steps:

  • Inclusion body isolation: Purify denatured lipase from inclusion bodies using standard denaturing conditions (typically 8M urea or 6M guanidine hydrochloride) .

  • Chaperone preparation: Similarly purify the recombinant chaperone, preferably using the truncated versions (Δ34 or Δ70) that show improved expression .

  • Refolding conditions: The most effective refolding occurs in a simple system of distilled water with incubation at 4°C for 24 hours .

  • Protein concentration: Maintain low protein concentrations during refolding (5-10 μg/ml of lipase) with an equal or slightly higher concentration of chaperone .

  • Molar ratio optimization: Ensure an excess of chaperone to lipase, as at least one chaperone molecule is required for each lipase molecule .

This methodology has yielded lipase with specific activities of 3,580 to 4,850 U/mg, comparable to or even exceeding the activity of lipase purified from native sources (3,470 U/mg) . Importantly, increasing protein concentration tenfold in the refolding mixture decreases efficiency by approximately eightfold, indicating the critical importance of dilute conditions during the refolding process .

How do different chaperone variants affect lipase refolding efficiency?

Different truncated and modified versions of the Lipase chaperone demonstrate varying efficiencies in lipase refolding, as shown in the following comparative data:

Chaperone VariantSpecific Activity with Native Chaperone (U/mg)Specific Activity with Denatured Chaperone (U/mg)
Δ70HpHis4,8504,660
Δ34HpHis6702,280
ompAΔ70HpHis1,0404,170
ompAΔ34HpHis1,7303,580

These data demonstrate that the Δ70HpHis variant (with 70 N-terminal amino acids truncated) provides the highest refolding efficiency, achieving a specific activity of 4,850 U/mg when used in its native form . Interestingly, some variants perform better when used in denatured form rather than native form during the refolding process.

How can researchers address the challenges of co-expression of lipase and its chaperone in heterologous systems?

Co-expression of lipase and its chaperone presents unique challenges but offers the advantage of in vivo folding. A methodological approach to address these challenges includes:

  • Vector design strategies:

    • Bicistronic expression vectors with both genes under control of a single promoter

    • Dual vector systems with compatible origins of replication

    • Vectors with different inducible promoters allowing sequential expression

  • Promoter selection:

    • For lipase: Strong promoters like λP RL have demonstrated high expression levels (up to 40% of total cellular protein)

    • For chaperone: Moderate expression is often sufficient, as excess chaperone is required

  • Optimization of expression conditions:

    • Temperature modulation (lower temperatures often improve folding)

    • Induction timing and inducer concentration

    • Media composition to support high-density growth

  • Cellular localization strategies:

    • Periplasmic targeting using appropriate signal sequences

    • Cytoplasmic co-expression with folding enhancers

  • Host strain selection:

    • BL21(DE3) derivatives for general expression

    • Origami strains for disulfide bond formation

    • Rosetta strains to address rare codon usage

The experimental design should include controls to verify both expression and folding. One effective approach is to express the proteins separately and together, then compare lipase activity levels to determine if in vivo folding is occurring efficiently. If in vivo folding is inefficient, the separate expression with in vitro refolding approach may be preferable .

What analytical methods are most appropriate for assessing the structural integrity and functional activity of recombinant lifO?

Comprehensive characterization of recombinant lifO requires multiple analytical approaches:

  • Structural integrity analysis:

    • SDS-PAGE for purity assessment (target ≥85% purity)

    • Size exclusion chromatography for aggregation analysis

    • Circular dichroism spectroscopy for secondary structure evaluation

    • Thermal shift assays to assess stability

    • Limited proteolysis to identify domain organization

  • Functional activity assessment:

    • Lipase refolding assays (gold standard)

    • Lipase activity measurements using standard substrates (p-nitrophenyl esters)

    • Fluorescence-based assays to monitor lipase-chaperone interactions

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Biophysical characterization:

    • Dynamic light scattering for homogeneity assessment

    • Analytical ultracentrifugation for oligomeric state determination

    • Mass spectrometry for accurate mass and post-translational modifications

When designing an analytical workflow, researchers should prioritize functional assays that directly measure the chaperone's ability to refold inactive lipase to its active state. The specific activity of refolded lipase (U/mg) provides a quantitative measure of chaperone functionality, with values approaching 4,850 U/mg indicating optimal activity .

How do Lipase chaperones from different Burkholderia species compare in structure and function?

Lipase chaperones from different Burkholderia species share similar functional roles but exhibit species-specific variations that impact their research applications:

  • Burkholderia cenocepacia Lipase chaperone:

    • Gene designation: Bcenmc03_3611, lifO

    • Functions as a lipase activator protein, foldase, and helper protein

    • Critical for proper folding of B. cenocepacia lipase

  • Burkholderia cepacia Lipase chaperone:

    • Gene designation: lipB, lifO

    • Well-characterized for recombinant expression and refolding

    • Extensively studied with truncated variants showing improved expression

  • Burkholderia glumae Lipase chaperone:

    • Gene designation: lifO, lipB

    • Functions similarly to other Burkholderia chaperones

    • May exhibit different substrate specificities

  • Pseudomonas sp. Lipase chaperone:

    • Gene designation: lifO, act, lipB

    • Shares functional similarities with Burkholderia chaperones

    • Additional transcriptional activator function (act designation)

When selecting a chaperone for research applications, consider the specific lipase being studied, as optimal folding typically occurs with the cognate chaperone-lipase pair. Cross-species compatibility exists but may result in reduced efficiency. For heterologous expression in any system, all these chaperones benefit from similar modifications, including N-terminal truncation and codon optimization .

What are the critical considerations for designing experiments to study lipase-chaperone interactions?

Designing robust experiments to study lipase-chaperone interactions requires careful attention to several methodological aspects:

  • Protein preparation:

    • Express and purify both proteins separately

    • Ensure proper folding of the chaperone

    • Prepare both native and denatured forms of lipase for interaction studies

    • Consider tagged and untagged versions to control for tag interference

  • Interaction analysis approaches:

    • Co-immunoprecipitation with antibodies against either protein

    • Pull-down assays using affinity-tagged versions

    • Analytical ultracentrifugation to determine complex formation

    • Cross-linking studies to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction sites

  • Kinetic considerations:

    • Time-course experiments to capture transient interactions

    • Temperature dependence studies (typically 4°C optimal for refolding)

    • Concentration dependence (dilute conditions of 5-10 μg/ml optimal)

  • Controls and validation:

    • Negative controls using non-cognate proteins

    • Positive controls using established interaction pairs

    • Validation using multiple complementary techniques

    • Functional validation through lipase activity assays

  • Data analysis:

    • Quantification of binding affinity and stoichiometry

    • Correlation between binding and functional outcomes

    • Statistical analysis to ensure reproducibility

The experimental approach should be tailored to address specific research questions. For mechanistic studies, techniques that provide structural information (such as hydrogen-deuterium exchange) are valuable, while for application-focused research, functional assays that measure refolding efficiency provide more relevant data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.