Recombinant Burkholderia cenocepacia Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
yidC; Bcen2424_3163; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRDHGRPSMFFPSATHTAPAAAGGASGTSATTAGDVP AAAAGAAPSTTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITLFD HTAGHTYLARTGLLGGDFPNHNDVYTQLNPGSTSLTGDENTLKLSFESPVKGGVKVVKTY TFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQ KIDFSDLDKNKANFEKSSDNGWVAMVQHYFASAWIPQQGAKRDIYAEKIDPTLYRVGVKQ PVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHGY VGNWGWAIVLLTVLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAALME LYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPFFILPVL MAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYI TRKLGGVKKKPA
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what functional role does it play in bacterial systems?

YidC functions as a membrane protein insertase that catalyzes the movement of polar domains across the hydrophobic lipid bilayer and serves as a chaperone for specific substrate proteins . It plays dual roles in bacterial systems: (1) functioning autonomously to facilitate membrane insertion of small membrane protein substrates and (2) operating as part of the Sec holotranslocon where it assists in membrane insertion processes and lateral clearance of substrate transmembrane segments . The protein is particularly important for energy-transducing respiratory complexes, ensuring their proper integration and assembly in the membrane . YidC's ability to help membrane proteins achieve their functional conformations makes it essential for bacterial survival and cellular energetics.

What are the recommended storage and handling protocols for recombinant YidC?

For optimal stability and activity, recombinant Burkholderia cenocepacia YidC should be stored as follows:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C upon receipt
Working aliquots4°C for up to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% (final concentration), 50% is standard
Freeze-thaw cyclesAvoid repeated cycles

Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom . After reconstitution, it's advisable to aliquot the protein to avoid repeated freeze-thaw cycles that could compromise its structural integrity and functional activity . Properly stored, the protein maintains >90% purity as determined by SDS-PAGE .

How do molecular dynamics simulations enhance our understanding of YidC's insertion mechanism?

Molecular dynamics (MD) simulations have been instrumental in characterizing the stability and biochemical properties of YidC in bacterial membranes . Both equilibrium and non-equilibrium MD simulations have proven effective for investigating the conformational dynamics involved in substrate insertion .

The simulation methodology typically involves:

  • Constructing a multiple sequence alignment of YidC homologs to identify conserved regions

  • Building a structural model using evolutionary covariation analysis and secondary structure predictions

  • Inserting the model into a membrane simulation environment (typically 3:1 POPE:POPG lipid composition)

  • Solvating with water layers and neutralizing with ions

  • Running simulations to observe protein behavior

MD simulations have revealed that while the five transmembrane helices form a rigid protein core, the polar loop regions are more dynamic and "swim" on the membrane surface . Analysis of inter-residue interactions within the transmembrane region shows that hydrophobic residues on the exterior stabilize interactions with lipid tails, while the core is stabilized by both short and long-range interactions between helices . The cytoplasmic side of the core contains primarily polar or charged residues engaged in electrostatic interactions, whereas the periplasmic side features aromatic residues involved in stacking and nonpolar dispersion interactions .

What experimental approaches best identify critical functional residues in YidC?

A multi-faceted approach combining computational prediction with experimental validation has proven most effective for identifying functionally critical residues in YidC:

  • Evolutionary covariation analysis: Computing direct evolutionary couplings between pairs of residues to identify potentially interacting amino acids that have co-evolved .

  • Lipid exposure prediction: Determining which residues face the lipid bilayer versus those that face the protein core, helping to identify residues involved in substrate interaction .

  • Molecular dynamics simulations: Identifying residues that contribute significantly to protein stability through inter-residue interaction analysis .

  • In vivo complementation assays: Creating alanine mutants of predicted key residues and testing their ability to complement YidC function in cells .

This combined approach has successfully identified critical residues like T362 in TM2 and Y517 in TM6, which when mutated to alanine completely inactivate YidC despite stable expression of the protein . Other residues (F433, M471, and F505) show intermediate activity levels when mutated, while mutations of residues further from the functional core have minimal effects .

What techniques are most effective for studying YidC-substrate interactions?

Disulfide crosslinking has proven particularly effective for studying YidC-substrate interactions . This technique involves:

  • Generating single-cysteine mutants in specific transmembrane domains of YidC

  • Reconstituting these mutants with ribosome-nascent chain complexes (RNCs) containing cysteine mutants of the substrate protein

  • Exposing the complexes to oxidizing agents like 5,5'-dithiobis-(2-nitrobenzoicacid) (DTNB)

  • Analyzing the resulting crosslinked products by SDS-PAGE and immunoblotting with antibodies against both the nascent chain and YidC

In one study, this approach revealed that the transmembrane domain of a substrate protein crosslinked specifically to TM3 of YidC but not to TM5, providing direct evidence for the orientation of the substrate during insertion . The crosslinked product appeared as a DTT-sensitive ~90 kDa band, representing the combined mass of the nascent chain-tRNA (~30 kDa) and YidC (~60 kDa) .

How was the structural model of YidC developed and validated?

The development of a structural model for YidC involved a sophisticated multi-step process:

  • Multiple sequence alignment: Starting with the PFAM seed alignment (PF02096) and using HHblits software to identify homologous sequences, researchers generated a non-redundant alignment at 90% sequence identity containing 2366 sequences .

  • Evolutionary covariation analysis: Direct evolutionary couplings between pairs of YidC residues were computed using the method of Kamisetty et al., revealing specific diagonal and anti-diagonal patterns of stronger coupling coefficients indicative of parallel or anti-parallel helix-helix pairs .

  • Helix positioning: Transmembrane helices were positioned according to covariation-based helix-helix contact predictions and rotated based on predicted lipid or protein exposure .

  • Model refinement: Additional structural restraints from residue-residue interactions and secondary structure predictions (Jpred 3) were incorporated using MODELLER .

The resulting model was validated through:

  • Molecular dynamics simulations: Testing stability in a membrane environment using NAMD 2.9 with the CHARMM36 force field .

  • Comparison with crystal structures: When crystal structures of Bacillus halodurans YidC2 (34% sequence identity with E. coli YidC) became available, the model showed good agreement with RMSD values of 7.5 Å and 7.3 Å, within the resolution limits of the prediction method .

  • In vivo complementation assays: Testing the functional importance of predicted key residues through alanine scanning mutagenesis .

What is the mechanism of YidC-mediated membrane protein insertion?

YidC facilitates membrane protein insertion through a mechanism involving several key steps:

  • Substrate targeting: While larger proteins typically use SRP-FtsY targeting to the Sec holotranslocon, smaller substrates that cannot engage SRP are post-translationally delivered to YidC . Some YidC-only substrates like MscL and tail-anchored proteins (TssL, DjlC, and Flk) employ SRP for targeting .

  • Hydrophilic cavity utilization: The unique hydrophilic cavity formed by YidC's 5-transmembrane core provides an environment that reduces the energetic barrier for polar domain translocation across the membrane .

  • Conformational dynamics: Both local and global conformational changes in YidC facilitate the insertion process . The hydrophilic cavity is accessible from both the cytoplasm and the lipid phase, allowing substrates to enter from the cytoplasmic side and exit laterally into the membrane .

  • Chaperone function: Beyond insertion, YidC ensures substrate proteins reach their functional conformation, acting as a foldase for proper protein assembly .

The precise pathway of substrate movement through YidC or the YidC/Sec holocomplex is still being elucidated, but electron density maps from cryo-EM studies have helped identify the positioning of substrate transmembrane domains relative to YidC's structure .

How does Burkholderia cenocepacia YidC compare with YidC proteins from other species?

The YidC family of proteins is widely conserved across all domains of life . Comparative analysis reveals:

CharacteristicBurkholderia cenocepacia YidCOther Bacterial YidCEukaryotic Homologs
Core structure5-transmembrane coreConserved 5-TM coreSimilar core structure with additional domains
Sequence identityReference34% with B. halodurans YidC2 Lower but structurally conserved
Hydrophilic cavityPresentPresentPresent in organellar homologs
FunctionInsertase/chaperoneInsertase/chaperoneInsertase/chaperone
Size (aa)552 Varies by speciesTypically larger

The conserved nature of YidC across bacteria and its homologs in eukaryotes suggests that the mechanistic details uncovered in model organisms like E. coli could be applied to understanding similar pathways in higher organisms . This conservation reflects the fundamental importance of this protein family in membrane protein biogenesis throughout evolution.

What insights does evolutionary covariation analysis provide about YidC structure and function?

Evolutionary covariation analysis has been instrumental in understanding YidC structure and function:

  • Identifying conserved interactions: By analyzing patterns of amino acid co-evolution across thousands of homologous sequences, researchers identified seven helix-helix contacts with probabilities above 57%, while all other possible contacts scored below 15%, demonstrating the specificity of the method .

  • Revealing structural constraints: The matrix of coupling strengths revealed diagonal and anti-diagonal patterns indicative of parallel or anti-parallel helix-helix pairs, providing insights into the three-dimensional arrangement of the transmembrane domains .

  • Guiding experimental design: The covariation analysis helped identify residues likely to be functionally important, guiding subsequent mutagenesis studies that confirmed their critical role .

  • Model validation: The structural model developed based on covariation analysis showed good agreement with subsequently determined crystal structures, validating the approach .

This approach is particularly valuable for membrane proteins like YidC that can be challenging to study by traditional structural biology methods, providing insights into evolutionary constraints that shape protein structure and function across diverse species.

How can recombinant YidC be utilized in reconstitution systems to study membrane protein insertion?

Recombinant YidC can be effectively utilized in reconstitution systems to study membrane protein insertion through the following methodological approaches:

  • Ribosome-nascent chain complex (RNC) reconstitution: Purified YidC can be reconstituted with RNCs containing stalled nascent membrane proteins to study co-translational insertion processes . For example, single-cysteine YidC mutants can be reconstituted with RNCs containing cysteine mutants of substrate proteins (like FₒC) for crosslinking studies .

  • Liposome reconstitution: Purified YidC can be incorporated into liposomes with defined lipid composition (typically 3:1 POPE:POPG) to create a controlled environment for studying insertion mechanisms . This approach allows researchers to manipulate lipid composition and other factors to examine their effects on YidC function.

  • Crosslinking experiments: Once reconstituted systems are established, various crosslinking approaches (disulfide, UV, chemical) can be employed to capture transient interactions during the insertion process . These experiments can identify which regions of YidC directly contact the substrate protein.

  • Fluorescence-based assays: Incorporating fluorescent labels into YidC and substrate proteins enables real-time monitoring of insertion kinetics and conformational changes using techniques like FRET.

When working with recombinant Burkholderia cenocepacia YidC, it's important to reconstitute the protein following recommended protocols to maintain its native structure and function .

What are the implications of YidC research for developing new antimicrobial strategies against Burkholderia cenocepacia?

Research on YidC has significant implications for developing antimicrobial strategies against Burkholderia cenocepacia for several reasons:

  • Essential cellular function: YidC plays a pivotal role in membrane protein biogenesis, particularly for energy-transducing respiratory complexes . Disrupting YidC function could therefore compromise cellular energetics and viability.

  • Unique structural features: The hydrophilic cavity formed by YidC's 5-transmembrane core represents a potential target for small molecule inhibitors . Compounds that bind to this cavity might interfere with substrate insertion and processing.

  • Species-specific targeting: While YidC is conserved across bacteria, there are sequence variations between species. Understanding the specific structural and functional characteristics of B. cenocepacia YidC could enable the design of species-selective inhibitors .

  • Resistance considerations: As an essential protein without known redundant pathways in bacteria, YidC inhibitors might face lower likelihood of resistance development compared to antibiotics targeting non-essential functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.