Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us; we will prioritize its inclusion.
Synonyms
mtgA; Bcen2424_0614; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
mtgA
Target Protein Sequence
MVAVSGTQRTRTVSLARWAVYAGSVFAGAWLATQLFYLAQIALWLFVNPGSTAFMRTDAW WLSRDTPPAQIRHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGR IVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETVLDKERIFEIYLNSVEWGRGV YGAEAAARYYYKIPASRLGAWQSARLAVMLPKPRWFDAHRGSAYQAQRAAVIARRMGAAE LPQSE
Uniprot No.

Target Background

Function

Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes the elongation of glycan chains from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia cenocepacia monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)?

Burkholderia cenocepacia monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme responsible for catalyzing the transglycosylation reaction during bacterial cell wall synthesis. It specifically polymerizes lipid II substrates to form the glycan chains of peptidoglycan, which is a crucial component of the bacterial cell wall. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase activities, mtgA functions solely as a glycosyltransferase, hence the term "monofunctional."

B. cenocepacia mtgA is encoded by the mtgA gene and belongs to the broader family of peptidoglycan glycosyltransferases. The full-length protein consists of 245 amino acids and includes a transmembrane domain that anchors it to the bacterial membrane, where it performs its catalytic function.

How is recombinant B. cenocepacia mtgA typically expressed and purified?

Recombinant B. cenocepacia mtgA is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The recombinant protein includes the full-length sequence (amino acids 1-245) to maintain complete functionality. After expression, the protein is typically purified using affinity chromatography, taking advantage of the His-tag for selective binding.

After purification, the protein is often lyophilized to form a powder, which enhances stability for storage. The purity of the recombinant protein should be confirmed by SDS-PAGE analysis, with greater than 90% purity being the standard for research applications.

How should recombinant mtgA be stored and handled in laboratory settings?

For optimal stability and activity, recombinant B. cenocepacia mtgA should be stored according to the following guidelines:

  • Long-term storage: Store the lyophilized powder at -20°C or -80°C.

  • Working aliquots: Store at 4°C for up to one week.

  • Buffer conditions: The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0.

  • Reconstitution: Prior to use, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Glycerol addition: For long-term storage of reconstituted protein, 5-50% glycerol (final concentration) should be added, with 50% being the standard recommendation.

It is important to avoid repeated freeze-thaw cycles as they can compromise protein stability and activity. Additionally, prior to opening, the vial should be briefly centrifuged to bring the contents to the bottom.

What is the proposed catalytic mechanism of peptidoglycan transglycosylases like mtgA?

Based on structural and functional studies of bacterial transglycosylases, particularly from S. aureus, the following catalytic mechanism has been proposed:

  • The enzyme has two key binding sites: a donor site and an acceptor site.

  • In the donor site, K140 and R148 (numbered according to S. aureus MtgA) play a critical role in stabilizing the pyrophosphate leaving group of lipid II, rather than the previously proposed E156.

  • In the acceptor site, E100 acts as a general base that deprotonates the 4-OH group of the GlcNAc residue.

  • This deprotonation facilitates the nucleophilic attack by the 4-OH on the C1 carbon of the GlcNAc residue in the donor site.

  • This results in the formation of a β-1,4-glycosidic bond, extending the growing peptidoglycan chain.

This mechanism has been supported by both crystallographic studies and mutagenesis experiments that demonstrate the importance of these conserved residues for enzymatic activity.

How does substrate binding occur in transglycosylases like mtgA?

Substrate binding in transglycosylases involves two distinct sites within the enzyme:

  • Glycosyl donor site: This site binds the growing peptidoglycan chain attached to lipid II. The growing chain is subsequently transferred to the acceptor lipid II molecule.

  • Glycosyl acceptor site: This site binds a disaccharide monomer lipid II, which acts as the acceptor for the growing chain.

Crystallographic studies have shown that moenomycin, a natural product inhibitor of transglycosylases, binds to the glycosyl donor site, preventing the binding of the growing peptidoglycan chain. The molecular details of lipid II binding to the glycosyl acceptor site are critical for understanding the mechanism of lipid II polymerization.

Interestingly, the transmembrane domain of transglycosylases has been found to influence substrate binding. Studies with E. coli PBP1b have shown that moenomycin binds with higher affinity to the full-length protein (including the transmembrane segment) compared to truncated versions lacking this domain. This suggests that the transmembrane region may play an important role in substrate recognition and binding.

How does mtgA contribute to B. cenocepacia pathogenesis, particularly in cystic fibrosis patients?

B. cenocepacia is an opportunistic pathogen that causes severe respiratory infections in immunocompromised patients, particularly those with cystic fibrosis. As a key enzyme in peptidoglycan synthesis, mtgA contributes to B. cenocepacia pathogenesis in several ways:

  • Cell wall integrity: By synthesizing peptidoglycan, mtgA ensures the structural integrity of the bacterial cell wall, which is essential for survival in the host environment.

  • Antibiotic resistance: The intrinsic antibiotic resistance of B. cenocepacia is partly attributed to its cell wall structure, which mtgA helps maintain.

  • Host colonization: Recent research using transposon sequencing (Tn-seq) has identified various fitness determinants in B. cenocepacia required for survival in infection models. While the specific role of mtgA was not directly mentioned in the search results, peptidoglycan synthesis genes are often identified as important fitness factors for host colonization.

  • Adhesion to host cells: B. cenocepacia adheres to the respiratory epithelium of cystic fibrosis patients through various mechanisms. Though trimeric autotransporter adhesins (TAAs) rather than mtgA were specifically mentioned in the search results, the intact cell wall structure facilitated by mtgA is likely important for proper display of adhesins on the bacterial surface.

In cystic fibrosis patients, the hypersecretion of mucus creates a viscoelastic material that facilitates bacterial adhesion and impairs host immune responses. B. cenocepacia can recognize O-linked glycans from host cell membranes, which may serve as binding sites for bacterial adhesion.

What inhibitors are known to target bacterial transglycosylases like mtgA?

Moenomycin is currently the only known natural product that directly inhibits the function of bacterial transglycosylases. It works by binding to the glycosyl donor site of the enzyme, preventing the binding of the growing peptidoglycan chain. Structurally, moenomycin mimics the growing peptidoglycan chain, which explains its high affinity for the donor site.

Despite its potent inhibitory activity, moenomycin cannot be used clinically in humans due to its poor pharmacokinetic properties. This has led to efforts to develop synthetic inhibitors targeting transglycosylases. Some approaches include:

  • Lipid II analogs that can compete with the natural substrate

  • Structure-based design of compounds that target the donor and/or acceptor sites

  • Development of substrate mimics that can block the polymerization reaction

The crystal structure of S. aureus MtgA in complex with a lipid II analog has provided valuable insights for the design of new inhibitors. By targeting the lipid II-contacting residues, which are conserved in both wild-type and drug-resistant bacteria, researchers hope to develop inhibitors that are less prone to resistance development.

What is the potential of mtgA as a therapeutic target for B. cenocepacia infections?

B. cenocepacia poses a significant clinical challenge due to its intrinsic antibiotic resistance and ability to cause persistent infections, particularly in cystic fibrosis patients. The potential of mtgA as a therapeutic target is supported by several factors:

  • Essential function: As a key enzyme in peptidoglycan synthesis, mtgA is essential for bacterial cell wall integrity and survival.

  • Surface accessibility: Being a membrane-bound enzyme involved in cell wall synthesis, mtgA is potentially accessible to inhibitors without needing to cross the bacterial membrane.

  • Conservation among pathogens: Transglycosylases are conserved across many bacterial species, suggesting that inhibitors targeting mtgA could potentially have broad-spectrum activity.

  • Novel target: While many antibiotics target the transpeptidase domain of PBPs (e.g., β-lactams), fewer target the transglycosylase activity, presenting an opportunity to overcome existing resistance mechanisms.

Recent genome-wide transposon sequencing (Tn-seq) approaches have been employed to identify novel drug targets for B. cenocepacia infections. These studies have revealed fitness determinants required for survival in infection models, which could serve as potential therapeutic targets. While mtgA was not specifically mentioned in the results, genes involved in cell wall synthesis are often identified as essential for bacterial survival in the host.

The development of effective inhibitors against mtgA could provide a new avenue for combating B. cenocepacia infections, particularly in vulnerable populations such as cystic fibrosis patients.

What methods are typically used to assess the enzymatic activity of recombinant mtgA?

Several methods can be employed to assess the enzymatic activity of recombinant mtgA:

  • Lipid II polymerization assay: This assay monitors the polymerization of radiolabeled or fluorescently labeled lipid II substrates. The products can be analyzed by paper chromatography, high-performance liquid chromatography (HPLC), or gel electrophoresis.

  • Moenomycin binding assay: Since moenomycin competitively inhibits transglycosylase activity by binding to the donor site, measuring the binding affinity of moenomycin to mtgA can provide insights into enzyme functionality.

  • In vitro peptidoglycan synthesis: Reconstituted systems using purified components (mtgA, lipid II, and other necessary factors) can be used to monitor the formation of peptidoglycan chains. The products can be analyzed by various methods, including mass spectrometry.

  • Fluorescence resonance energy transfer (FRET)-based assays: These assays use FRET-labeled lipid II analogs to monitor the transglycosylation reaction in real-time.

When designing these assays, it's important to consider that the full-length mtgA with its transmembrane segment has been shown to have higher activity than truncated forms, suggesting that the transmembrane domain plays a role in substrate binding and enzyme activity.

How can site-directed mutagenesis be used to study mtgA function?

Site-directed mutagenesis is a powerful approach for elucidating the functional roles of specific amino acid residues in mtgA. Based on studies of related transglycosylases, the following strategies can be employed:

  • Identification of key residues: Based on sequence alignments with other transglycosylases and available crystal structures (e.g., S. aureus MtgA), key residues potentially involved in substrate binding or catalysis can be identified.

  • Design of mutations: Specific mutations can be introduced to alter these key residues. Common approaches include:

    • Conservative substitutions to test the importance of specific functional groups

    • Alanine scanning to remove side chains completely

    • Charge reversals to test the importance of electrostatic interactions

  • Expression and purification: The mutant proteins are expressed and purified using the same methods as for the wild-type protein.

  • Activity assays: The enzymatic activity of the mutant proteins is compared to that of the wild-type protein using appropriate assays.

  • Structural analysis: Structural changes resulting from mutations can be assessed using techniques such as circular dichroism (CD) spectroscopy or X-ray crystallography.

Studies of S. aureus MtgA have implicated specific residues in the donor site (K140, R148) and acceptor site (E100) as being crucial for catalysis. Mutagenesis studies targeting the corresponding residues in B. cenocepacia mtgA could provide insights into the conservation of the catalytic mechanism across different bacterial species.

What are the challenges in crystallizing membrane-associated proteins like mtgA?

Crystallizing membrane-associated proteins like mtgA presents several challenges:

  • Membrane domain stability: The transmembrane helix of mtgA is hydrophobic and tends to aggregate in aqueous solutions. This can be addressed by:

    • Using detergents or lipids to solubilize the membrane domain

    • Employing bicelle methods, as used for S. aureus MtgA crystallization

    • Truncating the protein to remove the transmembrane domain, though this may affect activity

  • Protein flexibility: Transglycosylases often have flexible regions that can hinder crystal formation. Techniques to address this include:

    • Co-crystallization with inhibitors like moenomycin to stabilize the protein

    • Using substrate analogs to lock the enzyme in a specific conformation

    • Engineering disulfide bonds to reduce flexibility

  • Glycosylation and post-translational modifications: If present, these can introduce heterogeneity that complicates crystallization.

  • Expression and purification: Obtaining sufficient quantities of pure, homogeneous protein can be challenging for membrane proteins.

Despite these challenges, successful crystallization of related transglycosylases such as S. aureus MtgA has been achieved using approaches like the bicelle method, which provides a membrane-like environment for the protein. Co-crystallization with lipid II analogs has also proven successful in elucidating the structure of the enzyme-substrate complex.

How does the study of B. cenocepacia mtgA contribute to our understanding of antibiotic resistance?

The study of B. cenocepacia mtgA contributes to our understanding of antibiotic resistance in several ways:

  • Novel target identification: As many antibiotics target the transpeptidase domain of PBPs (e.g., β-lactams), understanding the structure and function of transglycosylases like mtgA can lead to the development of new antibiotics that target a different step in peptidoglycan synthesis.

  • Resistance mechanisms: B. cenocepacia exhibits intrinsic resistance to many antibiotics, partly due to its cell wall structure. Understanding how mtgA contributes to cell wall architecture can provide insights into these resistance mechanisms.

  • Conservation of essential functions: The lipid II-contacting residues in transglycosylases are conserved in both wild-type and drug-resistant bacteria, suggesting that inhibitors targeting these residues might be less prone to resistance development.

  • Role in persister cell formation: While not directly mentioned in the search results, dysregulation of peptidoglycan synthesis enzymes has been implicated in the formation of persister cells, which are tolerant to antibiotics and contribute to treatment failure.

Studies utilizing genome-wide approaches such as transposon sequencing (Tn-seq) have identified fitness determinants in B. cenocepacia that could serve as potential therapeutic targets. Targeting enzymes like mtgA, which are essential for bacterial survival but distinct from the targets of current antibiotics, offers a promising strategy to overcome existing resistance mechanisms.

What are the implications of recent structural studies on transglycosylases for drug design?

Recent structural studies on transglycosylases, particularly the crystal structure of S. aureus MtgA in complex with a lipid II analog, have significant implications for drug design:

  • Catalytic mechanism insights: The identification of K140 and R148 as residues that stabilize the pyrophosphate leaving group of lipid II, contrary to the previously proposed role of E156, provides new targets for inhibitor design.

  • Substrate binding sites: Detailed understanding of both the donor and acceptor sites allows for the design of inhibitors that can target either or both sites.

  • Conserved residues: The lipid II-contacting residues are conserved in both wild-type and drug-resistant bacteria, suggesting that inhibitors targeting these residues might be less prone to resistance development.

  • Transmembrane domain role: The finding that the transmembrane domain influences substrate binding and enzyme activity suggests that inhibitors that can interact with both the catalytic domain and the transmembrane segment might have enhanced potency.

  • Structural templates: The available crystal structures serve as templates for structure-based drug design, enabling the rational development of inhibitors with optimized binding properties.

These structural insights guide the development of new inhibitors that could overcome the pharmacokinetic limitations of moenomycin while maintaining its potent inhibitory activity against transglycosylases.

What is the relationship between mtgA and other virulence factors in B. cenocepacia pathogenesis?

While the search results do not directly address the relationship between mtgA and other virulence factors in B. cenocepacia, we can infer potential connections based on the available information:

  • Cell wall integrity and adhesin display: As an enzyme involved in peptidoglycan synthesis, mtgA contributes to cell wall integrity, which is essential for the proper display of surface virulence factors such as adhesins. The search results mention trimeric autotransporter adhesins (TAAs) as important virulence factors in B. cenocepacia, and their proper anchoring to the cell surface likely depends on a functional cell wall.

  • Genomic islands and virulence: Recent research has identified genomic islands in B. cenocepacia that are involved in O-antigen and lipopolysaccharide synthesis and required for virulence in infection models. The cell wall, which is partly synthesized by mtgA, works in concert with these surface structures to facilitate host colonization.

  • Mucin interaction: B. cenocepacia has been shown to adhere to mucin-coated surfaces, with the expression of certain adhesin genes (e.g., BCAM2418) dramatically increasing upon contact with mucins. The intact cell wall structure maintained by mtgA may be important for this interaction.

  • Fitness in infection models: Genome-wide transposon sequencing (Tn-seq) approaches have identified hundreds of fitness genes required for B. cenocepacia survival in infection models. While mtgA was not specifically mentioned, genes involved in cell wall synthesis often appear as important fitness determinants.

Understanding these relationships could lead to the development of combination therapies that target multiple virulence factors simultaneously, potentially enhancing treatment efficacy against B. cenocepacia infections.

Comparison of key residues in bacterial transglycosylases

Residue FunctionS. aureus MtgAE. coli PBP1bPotential Corresponding Residues in B. cenocepacia mtgA*
Donor site residues stabilizing pyrophosphateK140, R148-Conserved basic residues in similar positions
Acceptor site general baseE100-Conserved glutamate residue
Transmembrane interactionTM residues 83-88 interact with GT domain residues 292-296-Potential similar interactions

*Note: The exact residue numbers in B. cenocepacia mtgA would need to be determined through sequence alignment with S. aureus MtgA and E. coli PBP1b. This information was not directly provided in the search results.

Effect of transmembrane domain on transglycosylase activity

TransglycosylaseWith TM DomainWithout TM DomainEffect of TM Domain
E. coli PBP1bHigher activityLower activityEnhances enzymatic activity
S. aureus MtgAHigher activityLower activityEnhances enzymatic activity
S. pneumoniae PBP2a--Influences glycan chain length
E. coli PBP1bHigher affinity for moenomycinLower affinity for moenomycinEnhances inhibitor binding

These findings suggest that the transmembrane domain plays an important role in substrate binding, enzyme activity, and inhibitor interaction, highlighting the importance of including this domain in structural and functional studies of transglycosylases like mtgA.

cenocepacia virulence factors identified through Tn-seq

Infection ModelNumber of Fitness Genes IdentifiedExamples of Functional Categories
Galleria mellonella (in vivo)698O-antigen and lipopolysaccharide synthesis
Pig lung tissue (ex vivo)117-
Both models62-

This research identified a genomic island (I35_RS03700–I35_RS03770) involved in O-antigen and lipopolysaccharide synthesis that is required for virulence in the G. mellonella infection model but counteracts efficient colonization of pig lung tissue. While mtgA was not specifically mentioned among these fitness genes, the study highlights the power of the Tn-seq approach for identifying potential therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.