Recombinant Burkholderia cenocepacia NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Bcen2424_2249; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
nuoA
Target Protein Sequence
MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the immediate electron acceptor. This process couples the redox reaction to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental methods are used to study the function of nuoA in bacterial models?

Several experimental methods are employed to investigate the function of nuoA:

  • Gene deletion studies: Targeted deletion of nuoA using techniques like CRISPR-Cas9 or homologous recombination helps elucidate its role by observing phenotypic changes in mutant strains .

  • Proteomic analysis: Comparative proteomics can identify downstream effects on cellular metabolism and protein expression profiles resulting from nuoA deletion .

  • Enzymatic assays: Measuring NADH oxidation activity provides direct insights into the functional role of nuoA within the respiratory chain .

  • Electrophoretic mobility shift assays: These assays can be used to study protein-DNA interactions indirectly related to nuoA's regulatory roles .

How does the deletion of nuoA affect bacterial growth and metabolism?

The deletion of nuoA has been shown to impair bacterial growth during specific phases, particularly under conditions requiring high respiratory activity. For instance, studies on related bacterial strains revealed that while single deletions might not cause significant growth defects, double knockouts involving nuoA and other NADH dehydrogenases can lead to lethality or severe metabolic imbalances due to disrupted redox homeostasis . Proteomic analyses further indicate rerouting of carbon flux and altered expression of metabolic enzymes in nuoA mutants .

What challenges arise when interpreting data from nuoA knockout studies?

Data interpretation from knockout studies can be challenging due to several factors:

  • Redundancy in respiratory enzymes: The presence of multiple NADH dehydrogenases can mask the effects of single gene deletions, necessitating double or triple knockouts for conclusive results .

  • Compensatory mechanisms: Bacteria often activate alternative pathways to maintain metabolic balance, complicating direct attribution of observed phenotypes to nuoA loss .

  • Phase-specific effects: The impact of nuoA deletion may vary across growth phases, requiring time-resolved analyses to capture dynamic changes .

How does recombinant nuoA interact with other components of the respiratory chain?

Recombinant nuoA functions as part of the larger NADH dehydrogenase complex I, interacting with other subunits such as nuoB through nuoN. These interactions are essential for electron transfer and proton translocation. Studies have demonstrated that while individual subunits like nuoA are dispensable under certain conditions, their collective activity is vital for maintaining efficient respiration and energy production . Structural studies using techniques like cryo-electron microscopy could provide deeper insights into these interactions.

What role does nuoA play in antibiotic resistance mechanisms?

Although direct evidence linking nuoA to antibiotic resistance is limited, its role in maintaining cellular energy and redox balance indirectly supports resistance mechanisms. For example, disruptions in respiratory chain components can affect efflux pump activity and membrane integrity, influencing susceptibility to antibiotics such as polymyxin B . Further research is needed to explore these connections.

Can recombinant expression systems be used to study mutations in nuoA?

Yes, recombinant expression systems are ideal for studying mutations in nuoA. By introducing specific mutations into the nuoA gene and expressing it in a heterologous system like Escherichia coli, researchers can assess changes in enzymatic activity, structural stability, and interaction with quinones. Such studies help identify critical residues required for functionality and provide insights into evolutionary adaptations .

How do environmental factors influence the activity of recombinant nuoA?

Environmental factors such as oxygen availability, temperature, and substrate concentration significantly influence recombinant nuoA activity:

  • Oxygen levels: As part of an aerobic respiratory chain, optimal oxygen levels are required for efficient electron transfer.

  • Temperature: Enzyme kinetics are temperature-dependent; deviations from optimal conditions can reduce activity.

  • Substrate concentration: Availability of NADH and quinones directly impacts electron transport efficiency .

Controlled experimental setups are necessary to isolate these variables during functional assays.

What bioinformatics tools can be used to analyze the sequence and structure of nuoA?

Bioinformatics tools play a crucial role in analyzing the sequence and structure of nuoA:

  • Sequence alignment tools (e.g., BLAST): Identify conserved regions and homologs across different species.

  • Structural modeling software (e.g., PyMOL): Predict three-dimensional structures based on known templates.

  • Functional annotation platforms (e.g., KEGG): Map metabolic pathways involving nuoA.

  • Phylogenetic analysis tools: Explore evolutionary relationships among NADH dehydrogenase subunits across bacterial taxa .

These tools provide valuable insights into functional domains and evolutionary adaptations.

How does recombinant production affect post-translational modifications in nuoA?

Recombinant production often occurs in heterologous systems that may lack native post-translational modification machinery specific to Burkholderia cenocepacia. This can lead to altered folding or activity compared to native proteins. For instance, glycosylation patterns or phosphorylation states might differ between native and recombinant forms, impacting functionality . Optimizing host systems or co-expressing modifying enzymes could mitigate these issues.

What experimental controls are essential when studying recombinant nuoA?

Experimental controls are critical for ensuring reliable results:

  • Negative controls: Strains lacking recombinant protein expression confirm specificity.

  • Positive controls: Native protein assays validate functional comparisons.

  • Replication: Biological replicates ensure reproducibility.

  • Phase-specific analysis: Monitoring activity across growth phases accounts for dynamic changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.