Recombinant Burkholderia cenocepacia NADH-quinone oxidoreductase subunit K (nuoK)

What is the structural composition of Burkholderia cenocepacia NADH-quinone oxidoreductase subunit K?

Burkholderia cenocepacia NADH-quinone oxidoreductase subunit K (nuoK) is a relatively small protein consisting of 101 amino acids with the sequence: MLTLAHYLVLGAILFAIAIVGIFLNRRNVIIILMSIELMLLAVNTNFVAFSHYLGDVHGQIFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG . The protein has a predominantly hydrophobic composition, suggesting its role as a membrane protein component within the respiratory chain complex. When expressed recombinantly, it can be produced as a full-length protein (1-101 amino acids) fused to an N-terminal His-tag to facilitate purification and experimental manipulation .

How is recombinant B. cenocepacia nuoK typically expressed and purified for research applications?

Recombinant B. cenocepacia nuoK is typically expressed in Escherichia coli expression systems, which provide an efficient platform for producing substantial quantities of the protein . The protein is commonly expressed with a His-tag, allowing for efficient purification using nickel nitrilotriacetate column chromatography under non-denaturing conditions .

The purification process generally involves the following methodological steps:

• Expression of the His-tagged protein in E. coli

• Cell lysis under conditions that preserve protein structure

• Affinity chromatography using nickel columns

• Stepwise elution with increasing imidazole concentrations

• Confirmation of purity using SDS-PAGE (generally >90% purity is achieved)

• Final preparation as a lyophilized powder for long-term storage

What are the optimal storage and reconstitution conditions for recombinant nuoK protein?

For optimal stability and activity, recombinant nuoK should be stored and reconstituted following these methodological guidelines:

Storage conditions:

• Store lyophilized powder at -20°C/-80°C upon receipt

• Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

• Prepare small aliquots and store at -20°C/-80°C

How can I design experiments to study the subunit functionality of nuoK within the NADH-quinone oxidoreductase complex?

Studying the subunit functionality of nuoK requires careful experimental design to understand its role within the larger NADH-quinone oxidoreductase complex. Based on established methodologies in related oxidoreductase research, the following approach is recommended:

• Heterodimer expression strategy: Express wild-type/mutant heterodimers to isolate specific subunit functions. This can be achieved by tagging the wild-type subunit with polyhistidine while introducing specific mutations in the other subunit .

• Purification scheme:

  • Express the heterodimers in E. coli

  • Purify using stepwise elution with imidazole from a nickel nitrilotriacetate column under non-denaturing conditions

  • Confirm the composition of the purified heterodimer using:

    • SDS-PAGE

    • Nondenaturing polyacrylamide gel electrophoresis

    • Immunoblot analysis

• Enzyme kinetics analysis:

  • Study the enzyme kinetics with multiple electron acceptors (e.g., two-electron acceptors like 2,6-dichloroindophenol and menadione; four-electron acceptors like methyl red)

  • Measure and compare Km and kcat values for NADPH and NADH with wild-type, mutant, and heterodimer forms

This approach can provide insights into whether the subunits function independently or dependently with different electron acceptors and substrates.

What are the challenges in resolving contradictory data when studying nuoK expression in different experimental conditions?

When confronting contradictory data regarding nuoK expression and function, researchers should implement systematic approaches to identify the source of discrepancies:

• Standardize experimental variables:

  • Ensure consistent protein preparation methods across experiments

  • Document and control for environmental factors (temperature, pH, buffer composition)

  • Use standardized assay conditions and measurement techniques

• Data contradiction analysis framework:

  • Create a structured comparison table of contradictory findings

  • Evaluate methodological differences that might account for discrepancies

  • Assess statistical significance and reproducibility of each result

• Advanced validation approach:

  • Implement orthogonal experimental techniques to validate key findings

  • Design control experiments specifically addressing potential confounding factors

  • Consider using advanced natural language processing tools to systematically analyze the semantic consistency of reported findings across multiple studies

• Environmental adaptation context:

  • Consider that B. cenocepacia strains can undergo rapid evolution during infection or under stress conditions

  • Mutations can accumulate in clonal lineages as a response to suboptimal growth conditions

  • Variations in virulence and genotype can occur due to lung adaptation in clinical isolates

How does B. cenocepacia's nuoK contribute to the pathogen's virulence and drug resistance mechanisms?

Understanding nuoK's role in B. cenocepacia virulence and drug resistance requires integrating knowledge about the protein with the bacterium's pathogenic mechanisms:

B. cenocepacia is an opportunistic pathogen particularly dangerous for cystic fibrosis (CF) patients, capable of causing severe decline in lung function and potentially developing into life-threatening systemic infection known as cepacia syndrome . The NADH-quinone oxidoreductase complex, of which nuoK is a component, plays a crucial role in the respiratory chain and energy metabolism of the bacterium.

Research approaches to investigate this relationship include:

• Gene knockout studies:

  • Create nuoK deletion mutants using recombinant DNA techniques

  • Compare growth rates, biofilm formation, and virulence factor production between wild-type and mutant strains

  • Assess survival under antibiotic pressure and oxidative stress conditions

• Transcriptomic analysis:

  • Compare gene expression profiles of wild-type and nuoK mutants under various growth conditions

  • Identify co-regulated genes that may contribute to virulence and resistance

  • Map regulatory networks involving nuoK expression

• Infection models:

  • Test virulence of nuoK mutants in appropriate in vitro and in vivo models

  • Evaluate specific contribution to processes such as:

    • Intracellular survival

    • Biofilm formation

    • Resistance to host immune responses

    • Metabolic adaptation during infection

• Clinical context:

  • The epidemiology of B. cenocepacia infections varies geographically

  • B. cenocepacia and B. multivorans are most commonly isolated in Australia, New Zealand, and several European countries

  • Prevention and control strategies have led to a progressive decrease in Burkholderia cepacia complex prevalence

What are the optimal experimental conditions for studying nuoK protein interactions with other respiratory chain components?

To effectively study nuoK protein interactions with other respiratory chain components, researchers should implement the following experimental approach:

• Protein-protein interaction studies:

  • Co-immunoprecipitation with antibodies against nuoK or its interaction partners

  • Pull-down assays using the His-tagged recombinant nuoK as bait

  • Crosslinking experiments followed by mass spectrometry to identify interaction partners

  • Fluorescence resonance energy transfer (FRET) for studying dynamic interactions

• Reconstitution system design:

  • Use purified recombinant nuoK and other NADH-quinone oxidoreductase subunits

  • Reconstitute in artificial membrane systems such as liposomes or nanodiscs

  • Measure electron transfer rates and efficiency in the reconstituted system

  • Compare activity with native complexes isolated from B. cenocepacia

• Experimental variables to control:

  • pH conditions (typically maintained between 7.0-8.0 for optimal activity)

  • Temperature (25-37°C range for most assays)

  • Ionic strength of buffers

  • Detergent type and concentration for membrane protein solubilization

  • Presence of specific cofactors or substrates

• Data acquisition and analysis:

  • Use multiple technical and biological replicates

  • Apply appropriate statistical methods to evaluate significance

  • Implement controls for non-specific interactions and background signals

How can I effectively troubleshoot expression and purification issues with recombinant nuoK protein?

When troubleshooting recombinant nuoK expression and purification issues, implement this systematic methodology:

• Expression optimization strategy:

  Parameter	Recommended Variations	Analysis Method
  E. coli strain	BL21(DE3), Rosetta, C41/C43	Compare protein yield via SDS-PAGE
  Induction temperature	16°C, 25°C, 37°C	Monitor soluble fraction purity
  IPTG concentration	0.1 mM, 0.5 mM, 1.0 mM	Measure expression level
  Expression time	4 hours, overnight, 24 hours	Assess protein degradation
  Media composition	LB, TB, auto-induction	Evaluate final biomass and yield

• Solubilization troubleshooting:

  • Test multiple detergents (DDM, LDAO, Triton X-100) for membrane protein extraction

  • Optimize detergent concentration and buffer composition

  • Consider using mild solubilization conditions to maintain native structure

• Purification optimization:

  • Adjust imidazole concentrations in binding and elution buffers

  • Test different flow rates during chromatography

  • Implement additional purification steps (ion exchange, size exclusion) if needed

  • Verify protein identity using western blot or mass spectrometry

• Storage stability assessment:

  • Test protein stability at different temperatures and buffer conditions

  • Evaluate activity retention after freeze-thaw cycles

  • Consider alternative stabilizing agents beyond glycerol (trehalose, sucrose)

  • Monitor aggregation using dynamic light scattering or size exclusion chromatography

What are the best approaches for studying the role of nuoK in B. cenocepacia metabolism and antibiotic resistance?

To investigate nuoK's role in B. cenocepacia metabolism and antibiotic resistance, researchers should consider these methodological approaches:

• Metabolomic analysis:

  • Compare metabolite profiles between wild-type and nuoK mutant strains

  • Focus on energy metabolism intermediates and respiratory chain substrates

  • Trace metabolic flux using stable isotope labeling

  • Correlate metabolic changes with resistance phenotypes

• Resistance phenotyping:

  • Determine minimum inhibitory concentrations (MICs) for various antibiotics

  • Assess growth dynamics under antibiotic challenge using high-resolution growth curves

  • Evaluate biofilm formation capacity and antibiotic penetration

  • Measure membrane potential and proton gradient maintenance

  • Analyze cross-resistance patterns to identify resistance mechanisms

• Gene expression modulation:

  • Implement controlled expression systems (inducible promoters)

  • Create nuoK variants with specific mutations to test function

  • Use antisense RNA or CRISPR interference for targeted knockdown

  • Complement mutant strains with wild-type or modified nuoK

• Clinical relevance assessment:

  • Compare findings with clinical isolates of B. cenocepacia

  • Consider the adaptation of strains during chronic infection in CF patients

  • Evaluate phenotypic variations in epidemic versus non-epidemic strains

  • Account for the bacterium's rapid evolution under stress conditions

How should I analyze the kinetic parameters of nuoK-containing enzyme complexes?

When analyzing kinetic parameters of enzyme complexes containing nuoK, implement this structured analytical approach:

• Steady-state kinetics methodology:

  • Measure initial reaction velocities under various substrate concentrations

  • Plot data using appropriate models (Michaelis-Menten, Lineweaver-Burk, Eadie-Hofstee)

  • Determine key parameters (Km, Vmax, kcat, catalytic efficiency) using non-linear regression

  • Evaluate the effect of nuoK mutations on kinetic parameters

• Comparative analysis framework:

  Parameter	Wild-type Complex	NuoK Mutant Complex	Heterodimer Complex
  Km(NADPH)	Baseline value	Compare to baseline	Compare to baseline
  Km(NADH)	Baseline value	Compare to baseline	Compare to baseline
  kcat(NADPH)	Baseline value	Compare to baseline	~50% of wild-type*
  kcat(NADH)	Baseline value	Compare to baseline	~50% of wild-type*

  *Based on similar experiments with NAD(P)H:quinone oxidoreductase

• Electron acceptor-specific analysis:

  • Examine responses to different electron acceptors separately

  • Two-electron acceptors (e.g., 2,6-dichloroindophenol, menadione)

  • Four-electron acceptors (e.g., methyl red)

  • Compare parameters to identify subunit cooperation patterns

• Advanced kinetic modeling:

  • Test for cooperative effects using Hill coefficient analysis

  • Evaluate the impact of environmental factors (pH, temperature, ionic strength)

  • Consider applying global fitting approaches to complex kinetic models

  • Use simulation tools to predict behavior under physiological conditions

What statistical approaches are most appropriate for evaluating nuoK expression data under different experimental conditions?

When analyzing nuoK expression data across different experimental conditions, implement these statistical methodologies:

• Experimental design considerations:

  • Use appropriate sample sizes based on power analysis

  • Include both biological and technical replicates

  • Implement randomization and blinding where possible

  • Include proper positive and negative controls

• Normalization strategies:

  • Select appropriate reference genes for qPCR normalization

  • Account for batch effects in multi-batch experiments

  • Normalize protein expression data to total protein content or housekeeping proteins

  • Consider global normalization methods for high-throughput data

• Statistical testing framework:

  • For comparing two conditions: t-test (parametric) or Mann-Whitney U test (non-parametric)

  • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni, etc.)

  • For time-course data: repeated measures ANOVA or mixed models

  • For complex experimental designs: factorial ANOVA or generalized linear models

• Advanced data analysis approaches:

  • Implement multivariate analysis for complex datasets

  • Use cluster analysis to identify patterns across conditions

  • Apply machine learning approaches for predictive modeling

  • Conduct sensitivity analysis to identify key experimental variables

  • Consider Bayesian statistical approaches for integrating prior knowledge

How can I integrate nuoK structural data with functional analyses to develop targeted inhibitors?

Integrating structural and functional data for nuoK to develop targeted inhibitors requires a multidisciplinary approach:

• Structural characterization methodology:

  • Generate high-resolution structures using X-ray crystallography or cryo-electron microscopy

  • Perform molecular dynamics simulations to identify flexible regions and binding pockets

  • Map the amino acid conservation across species to identify critical functional domains

  • Model nuoK's position and interactions within the complete NADH-quinone oxidoreductase complex

• Structure-function correlation:

  • Design site-directed mutagenesis experiments targeting predicted functional residues

  • Evaluate the impact of mutations on enzyme kinetics, stability, and complex assembly

  • Identify residues critical for electron transfer or substrate binding

  • Map regions involved in protein-protein interactions within the respiratory complex

• Inhibitor design strategy:

  • Conduct virtual screening against identified binding pockets

  • Design structure-based pharmacophores based on substrate interactions

  • Synthesize candidate compounds with predicted activity

  • Test inhibitors against purified protein, bacterial membranes, and whole cells

• Therapeutic potential assessment:

  • Evaluate inhibitor specificity against human homologs

  • Test activity against clinical isolates of B. cenocepacia, particularly from CF patients

  • Assess synergy with existing antibiotics

  • Consider the potential application in combination therapies for CF patients

How can recombinant nuoK be utilized in developing new therapeutic approaches for B. cenocepacia infections?

Recombinant nuoK offers several avenues for therapeutic development against B. cenocepacia infections, particularly important given the pathogen's resistance to conventional antibiotics:

• Vaccine development approach:

  • Evaluate recombinant nuoK as a potential vaccine antigen

  • Determine immunogenicity in appropriate animal models

  • Assess protective efficacy against B. cenocepacia challenge

  • Consider conjugation to carrier proteins or adjuvants to enhance immunogenicity

• Inhibitor screening platform:

  • Develop high-throughput assays using recombinant nuoK

  • Screen compound libraries for specific inhibitors

  • Validate hits against whole bacterial cells

  • Optimize lead compounds for potency and selectivity

• Diagnostic application:

  • Develop antibodies against specific nuoK epitopes

  • Create rapid diagnostic tests for B. cenocepacia identification

  • Differentiate between epidemic and non-epidemic strains

  • Monitor treatment response in CF patients

• Clinical relevance context:

  • B. cenocepacia is particularly dangerous for CF patients

  • It can cause severe decline in lung function and potentially life-threatening systemic infection

  • Current prevention and control strategies have reduced but not eliminated Bcc prevalence

  • Alternative therapies are urgently needed to improve CF patients' life expectancy

What experimental approaches can determine if nuoK mutations contribute to B. cenocepacia strain variation and virulence?

To investigate whether nuoK mutations contribute to B. cenocepacia strain variation and virulence, implement these experimental approaches:

• Comparative genomics strategy:

  • Sequence nuoK genes from multiple clinical and environmental isolates

  • Compare sequences to identify natural variations and potential adaptive mutations

  • Correlate sequence variations with geographical distribution and epidemic potential

  • Analyze selection pressure acting on nuoK coding sequences

• Functional characterization methodology:

  • Express and purify variants of nuoK identified from different strains

  • Compare biochemical properties and kinetic parameters

  • Assess impact on respiratory chain function and energy metabolism

  • Evaluate contribution to stress response and antibiotic resistance

• Virulence assessment framework:

  • Create isogenic strains differing only in nuoK sequence

  • Test virulence in appropriate infection models

  • Measure bacterial survival under host-relevant stress conditions

  • Evaluate biofilm formation, invasion capability, and intracellular persistence

• Clinical correlation:

  • An epidemic B. cenocepacia clone prevalent in Serbian CF population (ST856) shows variations in virulence and genotype as a consequence of lung adaptation

  • Novel Bcc infections in many countries are caused by non-epidemic B. cenocepacia strains or non-clonal B. multivorans

  • Environmental acquisition rather than cross-infection appears to be the primary source of new infections under current control measures