Recombinant Burkholderia cenocepacia Probable intracellular septation protein A (Bcenmc03_1933)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Bcenmc03_1933 encodes a 176-amino-acid protein (UniProt ID: B1JTT7) with a molecular weight of 20.1 kDa and an isoelectric point (pI) of 10.25 . It belongs to the YciB family and is conserved across Burkholderia species, including pathogenic strains . Recombinant versions are typically expressed in E. coli with an N-terminal His tag for purification .

Genomic Context and Evolutionary Insights

The Bcenmc03_1933 gene is located on chromosome 1 of B. cenocepacia MC0-3 (GenBank: ACA91094.1) and is part of the Burkholderia Ortholog Group BG001774, which includes 653 members across Burkholderia species . Comparative genomic analyses of 116 Burkholderia cepacia complex (Bcc) strains revealed:

  • Evolutionary Dynamics:

    • Bcc core genes, including those involved in septation, exhibit high rates of homologous recombination, particularly between species (67.1% inter-species vs. 32.9% intra-species events) .

    • Positive selection was detected in 11 core genes, including those in functional categories like translation (J) and inorganic ion transport (P), though Bcenmc03_1933 itself was not explicitly listed .

Genomic Features

FeatureDetail
Genomic LocationChromosome 1: 2,146,109–2,146,639 (+ strand)
Locus TagBCENMC03_RS09730
COG CategoryCell division/septation (M)
Subcellular LocalizationInner membrane (predicted transmembrane α-helix structure)

Functional Role

Bcenmc03_1933 is implicated in intracellular septation and cell division, critical for bacterial proliferation. Key functional attributes include:

  • Domain Architecture: Single-domain structure with a conserved YciB family motif .

  • Interaction Networks: Predicted to interact with other cell division proteins, though specific partners remain uncharacterized .

Research Applications

Recombinant Bcenmc03_1933 is commercially available for:

  • Mechanistic Studies: Investigating septation mechanisms in Burkholderia .

  • Antimicrobial Development: Targeting cell division pathways in multidrug-resistant pathogens .

  • Structural Biology: Crystallization and NMR studies (lyophilized form enhances stability) .

Future Directions

Further studies are needed to:

  • Elucidate its interaction partners using yeast two-hybrid or co-IP assays .

  • Explore its role in B. cenocepacia virulence and biofilm formation .

  • Develop inhibitors targeting its membrane-associated domains .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yciB; Bcenmc03_1933; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain MC0-3)
Target Names
Bcenmc03_1933
Target Protein Sequence
MKFLFDLFPIILFFVAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGKNLIEKMMGKQLTLPVPVWDKLN VAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bcenmc03_1933 and what is its role in bacterial cell processes?

Bcenmc03_1933 is a probable intracellular septation protein A from Burkholderia cenocepacia (strain MC0-3). It belongs to the YciB protein family and is primarily involved in cell division processes, specifically intracellular septation. The protein consists of 176 amino acids with a molecular mass of 20.112 kDa. Its sequence suggests a membrane-associated protein that likely participates in the formation of the septum during bacterial cell division .

How does Bcenmc03_1933 fit into the broader context of Burkholderia cenocepacia pathogenicity?

B. cenocepacia is recognized as an opportunistic pathogen associated with chronic lung infections in cystic fibrosis patients . While the direct role of Bcenmc03_1933 in virulence has not been specifically characterized in the available literature, cell division proteins are essential for bacterial replication and persistence during infection. The pathogenicity of B. cenocepacia involves complex regulatory networks including cyclic di-GMP signaling, which controls biofilm formation, motility, and virulence factors . As a cell division protein, Bcenmc03_1933 may be integrated within these regulatory pathways, potentially influencing bacterial adaptation during host infection.

What optimized approaches should be used for recombinant expression of Bcenmc03_1933?

For optimal recombinant expression of Bcenmc03_1933, researchers should implement a Design of Experiments (DoE) approach rather than the inefficient one-factor-at-a-time method. DoE allows for investigation of multiple parameters simultaneously with a carefully selected small set of experiments, reducing cost and time while predicting the effect of each factor and their interactions . For this membrane-associated protein, expression considerations should include:

ParameterOptimization StrategyRationale
Expression hostE. coli BL21(DE3) or C41/C43 strainsSpecialized strains for membrane proteins
Induction temperatureTest range from 16°C to 30°CLower temperatures may reduce aggregation
Inducer concentrationMultiple IPTG levels (0.1-1.0 mM)Optimal protein folding
Media compositionRich vs. minimal mediaNutrient availability affects expression
Fusion tagsN-terminal and C-terminal tagsEnhance solubility and detection

Implementing Response Surface Methodology (RSM) can help identify optimal conditions by analyzing how multiple factors interact to affect protein expression yield and solubility .

What challenges are specific to purifying full-length Bcenmc03_1933 and how can they be addressed?

Purification of full-length Bcenmc03_1933 presents several challenges typical of membrane-associated proteins. Common issues include protein hydrophobicity, translation initiation problems leading to truncated products, and potential toxicity to expression hosts . To address these challenges:

  • Analyze the protein sequence for hydrophobic regions that might cause aggregation

  • Design constructs with fusion tags at both N- and C-termini to distinguish full-length protein from truncated products

  • Optimize lysis conditions using detergents appropriate for membrane proteins

  • Employ gradient elution with increasing imidazole concentrations during affinity chromatography to separate full-length protein from fragments

  • Validate protein integrity through mass spectrometry to confirm the complete 176 amino acid sequence

How can researchers apply Design of Experiments to optimize Bcenmc03_1933 characterization studies?

Implementing DoE for Bcenmc03_1933 characterization should focus on systematic evaluation of experimental factors. This approach allows researchers to:

  • Identify critical parameters affecting protein activity using factorial design

  • Determine optimal buffer conditions (pH, salt concentration, additives) for functional assays

  • Develop robust activity assays with appropriate statistical validation

  • Establish reproducible conditions for structural studies

Several software packages can facilitate DoE implementation, guiding experiment design and result analysis . For functional characterization, researchers should employ a fractional factorial design to initially screen important factors followed by response surface methodology to fine-tune conditions for maximum protein stability and activity.

What controls and validation methods are essential for Bcenmc03_1933 functional studies?

Rigorous experimental design for Bcenmc03_1933 functional studies requires comprehensive controls:

Control TypeSpecific ExamplesPurpose
Negative controlsInactive mutants (point mutations in conserved residues)Verify specificity of observed activities
Positive controlsComplementation with wild-type proteinConfirm phenotype rescue
System controlsEmpty vector expressionAccount for expression system effects
Technical controlsProtein stability/degradation monitoringEnsure observed effects are due to protein function

Validation should include multiple orthogonal techniques to confirm protein activity, such as combining in vitro biochemical assays with in vivo functional studies in B. cenocepacia mutants.

How can researchers investigate the interaction between Bcenmc03_1933 and the cyclic di-GMP signaling pathway?

Cyclic di-GMP is a key regulator of biofilm formation, motility, and virulence in B. cenocepacia . To investigate potential interactions between Bcenmc03_1933 and this signaling pathway:

  • Construct B. cenocepacia strains with varying c-di-GMP levels through manipulation of diguanylate cyclases (e.g., RpfR) and phosphodiesterases

  • Monitor Bcenmc03_1933 expression levels under different c-di-GMP conditions using qRT-PCR and Western blot analysis

  • Examine cell division patterns and septation in strains with altered c-di-GMP levels

  • Test for direct binding between Bcenmc03_1933 and c-di-GMP using techniques such as differential scanning fluorimetry or isothermal titration calorimetry

  • Investigate protein localization changes in response to varying c-di-GMP levels using fluorescently-tagged Bcenmc03_1933

This research would build on existing knowledge of c-di-GMP as a key regulator in B. cenocepacia while extending it to cell division processes.

What approaches can reveal the structural basis of Bcenmc03_1933 function?

Structural characterization of Bcenmc03_1933 requires multiple complementary techniques:

  • Secondary structure prediction based on the amino acid sequence to identify transmembrane domains and functional motifs

  • Circular dichroism spectroscopy to experimentally confirm secondary structure elements

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination, requiring:

    • Optimization of detergent conditions for membrane protein stability

    • Screening of crystallization conditions

    • Validation of protein functional state in crystallization buffers

  • Molecular dynamics simulations to model protein behavior in a lipid bilayer environment

  • Structure-guided mutagenesis of conserved residues to correlate structural features with function

These approaches should focus on understanding how the YciB family structural features contribute to septation functions.

How might Bcenmc03_1933 contribute to B. cenocepacia persistence in cystic fibrosis infections?

B. cenocepacia is known as an opportunistic pathogen in cystic fibrosis patients . To investigate Bcenmc03_1933's potential role in persistence:

  • Generate knockout and conditional mutants of Bcenmc03_1933 in B. cenocepacia

  • Compare growth kinetics and cell morphology between wild-type and mutant strains under various stress conditions relevant to the CF lung (oxidative stress, antibiotic pressure, nutrient limitation)

  • Evaluate biofilm formation capabilities, as biofilms contribute significantly to bacterial persistence

  • Assess virulence in appropriate infection models (ex vivo lung tissue models or Galleria mellonella infection model)

  • Examine expression levels of Bcenmc03_1933 in clinical isolates from chronic versus acute infections

This research would provide insights into whether cell division processes mediated by Bcenmc03_1933 are adapted for persistence in the hostile environment of CF lungs.

How does Bcenmc03_1933 function differ between planktonic and biofilm states?

Biofilm formation is a key virulence factor for B. cenocepacia in cystic fibrosis infections. To investigate differential function:

  • Compare expression levels of Bcenmc03_1933 between planktonic and biofilm growth using transcriptomics and proteomics

  • Visualize protein localization patterns using fluorescently-tagged Bcenmc03_1933 in both growth states

  • Examine cell division dynamics and septation patterns in biofilms versus planktonic cells using time-lapse microscopy

  • Determine if Bcenmc03_1933 knockout affects biofilm architecture or stability

  • Investigate whether the protein interacts with biofilm matrix components

This research would connect cell division processes to the biofilm lifestyle that contributes to B. cenocepacia persistence.

How conserved is Bcenmc03_1933 across Burkholderia species and what does this suggest about its evolutionary significance?

Comparative genomic analysis of Bcenmc03_1933 homologs across Burkholderia species can reveal evolutionary patterns:

  • Identify homologs in related species including B. pseudomallei, B. thailandensis , and B. multivorans

  • Perform sequence alignment and phylogenetic analysis to determine conservation levels

  • Compare genomic context (neighboring genes) across species to identify conserved operons

  • Correlate sequence conservation with species' pathogenicity and host range

  • Identify selection pressures on different protein domains through Ka/Ks ratio analysis

How can researchers leverage information from other bacterial septation systems to understand Bcenmc03_1933?

The YciB protein family, to which Bcenmc03_1933 belongs , is found across bacterial species. Researchers can:

  • Compare characterized YciB family members from model organisms to identify conserved functional domains

  • Examine whether complementation with YciB proteins from other species can rescue Bcenmc03_1933 mutant phenotypes

  • Analyze differences in YciB proteins between environmental and pathogenic Burkholderia species

  • Investigate whether septation mechanisms in Burkholderia have unique adaptations compared to model organisms

This comparative approach leverages existing knowledge from well-studied bacterial systems to accelerate understanding of this specific protein.

How can photothermal nanoblade delivery be applied to study Bcenmc03_1933 function in host cells?

Photothermal nanoblade delivery allows efficient placement of bacterium-sized cargo into mammalian cell cytoplasm . This technique could be applied to study Bcenmc03_1933 by:

  • Delivering B. cenocepacia wild-type and Bcenmc03_1933 mutant strains directly into host cells

  • Bypassing initial invasion steps to focus on intracellular replication and cell-to-cell spread

  • Observing septation processes in the intracellular environment

  • Comparing intracellular growth kinetics between wild-type and mutant strains

  • Examining host cell responses to bacterial replication and division

This approach would build on methods used to study related Burkholderia species while focusing specifically on the role of septation proteins during intracellular infection.

What protein-protein interaction methods are most suitable for identifying Bcenmc03_1933 binding partners?

To identify proteins that interact with Bcenmc03_1933 during septation:

  • Bacterial two-hybrid system adapted for membrane proteins

  • Co-immunoprecipitation with epitope-tagged Bcenmc03_1933 followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Förster resonance energy transfer (FRET) to validate specific interactions in vivo

  • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

These methods should be applied in both laboratory culture conditions and infection-relevant environments to identify context-dependent interactions.

What criteria should be evaluated to assess Bcenmc03_1933 as a potential therapeutic target?

To evaluate Bcenmc03_1933 as a potential antibiotic target against B. cenocepacia infections:

  • Essentiality: Determine whether the protein is essential for bacterial survival using conditional knockouts

  • Conservation: Assess conservation across Burkholderia species but divergence from human proteins

  • Accessibility: Evaluate whether small molecules could access the protein target

  • Druggability: Identify potential binding pockets through structural analysis

  • Resistance potential: Assess the likelihood of resistance development through mutation

This assessment would help determine whether targeting Bcenmc03_1933 could provide a new approach against this opportunistic pathogen that often shows extensive antibiotic resistance.

How can high-throughput screening approaches be adapted to identify inhibitors of Bcenmc03_1933?

Development of screening assays for Bcenmc03_1933 inhibitors requires:

  • Establishing a functional assay reflecting the protein's role in septation

  • Adapting the assay to a format compatible with high-throughput screening

  • Developing secondary assays to eliminate false positives

  • Including counter-screens against human proteins to assess selectivity

  • Validating hits through structural studies of protein-inhibitor complexes

Such screening approaches would need to account for the membrane-associated nature of the protein and its role in complex cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.