Recombinant Burkholderia cenocepacia Probable intracellular septation protein A (Bcen_6169)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Bcen_6169 is annotated as a probable intracellular septation protein, though its specific mechanistic role remains underexplored. Key observations include:

  • Homology: Shares structural domains with inner membrane-spanning proteins involved in bacterial cell division .

  • Genomic Context: Located within the core genome of B. cenocepacia, a species prone to recombination events that drive genetic diversity .

  • Pathogenicity Link: While not directly characterized as a virulence factor, B. cenocepacia relies on septation proteins for survival in host environments .

Comparative Genomic Analysis

Studies reveal that B. cenocepacia strains cluster into two evolutionary clades :

CladeFeaturesBcen_6169 Presence
Clinical IsolatesEnriched with virulence factors (e.g., BCESM, cblA)Conserved
EnvironmentalLacks key virulence genes; enriched in plant-associated metabolic pathwaysConserved

Research Applications

This recombinant protein serves as a critical reagent in:

  1. Antibody Development: Used in ELISA assays to generate specific antibodies for detecting B. cenocepacia infections .

  2. Mechanistic Studies: Facilitates structural analyses of bacterial septation machinery .

  3. Host-Pathogen Interaction Models: Informs studies on B. cenocepacia persistence in immunocompromised hosts .

Unresolved Questions

  • Does Bcen_6169 interact with host immune components (e.g., pyrin inflammasome) like other B. cenocepacia effectors (e.g., TecA) ?

  • What role does its membrane-spanning domain play in bacterial replication under stress conditions?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Bcen_6169; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain AU 1054)
Target Names
Bcen_6169
Target Protein Sequence
MKFLFDLFPIILFFVAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGKNLIEKMMGKQLTLPVPVWDKLN VAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of Bcen_6169 protein?

Bcen_6169 is classified as a transmembrane protein with hydrophobic regions that anchor it within the bacterial cell membrane. The protein's hydrophobicity profile indicates multiple membrane-spanning domains, which is consistent with its role in septation processes. Its full-length structure includes both hydrophobic transmembrane regions and hydrophilic sections that interact with the cytoplasmic environment. As with many membrane proteins, obtaining high-resolution structural data presents significant challenges, and computational predictions may be necessary to supplement experimental approaches. The protein's structure-function relationship remains an active area of investigation, particularly regarding how its conformation relates to its role in bacterial cell division .

How is recombinant Bcen_6169 typically supplied and stored?

Recombinant Bcen_6169 is typically supplied as a lyophilized powder in Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For proper storage and handling:

  • Upon receipt, the vial should be briefly centrifuged to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage

  • Working aliquots can be stored at 4°C for up to one week

The purity of commercial preparations typically exceeds 90% as determined by SDS-PAGE analysis .

What are the optimal expression conditions for recombinant Bcen_6169?

Optimizing expression conditions for recombinant Bcen_6169 requires addressing several challenges inherent to membrane proteins:

ParameterRecommendationRationale
Expression systemE. coli BL21(DE3) or C41(DE3)C41(DE3) strain is specifically designed for toxic or membrane proteins
Temperature16-18°C post-inductionLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMLower concentrations promote proper folding
Induction time16-20 hoursExtended time compensates for slower expression at lower temperatures
Media supplements1% glucose, 1 mM betaineGlucose represses basal expression; betaine acts as osmolyte to promote folding

When expressing this transmembrane protein, codon optimization for E. coli is recommended to address potential rare codon issues that could hamper translation efficiency. Additionally, fusion tags at both N and C termini can help distinguish full-length protein from truncated products that may result from translation initiation problems .

What purification strategy is most effective for recombinant Bcen_6169?

Purifying recombinant His-tagged Bcen_6169 requires a specialized approach due to its membrane-associated nature:

  • Cell lysis and membrane fraction isolation:

    • Sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Ultracentrifugation at 100,000×g to separate membrane fraction

    • Resuspension of membrane pellet in solubilization buffer

  • Membrane protein solubilization:

    • Use of mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2%

    • Addition of 10% glycerol to enhance protein stability

    • Gentle rotation at 4°C for 1-2 hours

  • Affinity chromatography:

    • Ni-NTA resin equilibrated with buffer containing 0.05% DDM

    • Gradient elution with imidazole (50-500 mM)

    • Use of higher imidazole concentrations to distinguish full-length protein from truncated products

  • Size exclusion chromatography:

    • Further purification using Superdex 200 column

    • Buffer containing 0.05% DDM to maintain protein solubility

This protocol typically yields protein with >90% purity suitable for functional and structural studies .

How can I assess the functional activity of purified Bcen_6169?

Assessing functional activity of Bcen_6169 requires multiple complementary approaches:

  • In vitro membrane association assays:

    • Liposome binding assays using fluorescently labeled protein

    • Assessment of protein incorporation into artificial membranes

    • Measurement of lipid binding specificity using liposomes of varying composition

  • Cell division phenotype complementation:

    • Expression of Bcen_6169 in bacterial strains with septation defects

    • Microscopic analysis of cell morphology and division patterns

    • Quantification of restoration of normal cell division

  • Protein-protein interaction studies:

    • Pull-down assays with other known septation proteins

    • Bacterial two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation experiments followed by mass spectrometry

  • GTPase activity assays (if applicable):

    • Measurement of phosphate release using colorimetric methods

    • Assessment of nucleotide binding using fluorescent nucleotide analogs

These functional analyses should be conducted across multiple experimental replicates with appropriate positive and negative controls to ensure reproducibility and specificity .

How can multi-dataset analysis improve our understanding of Bcen_6169 function?

Integrating multiple datasets provides robust insights into Bcen_6169 function through complementary approaches:

  • Cross-platform transcriptomic analysis:

    • Integration of RNA-seq, microarray, and qRT-PCR data

    • Identification of consistent expression patterns across experimental conditions

    • Network analysis to identify co-regulated genes

  • Proteomic data integration:

    • Correlation of Bcen_6169 expression with global proteome changes

    • Identification of post-translational modifications across conditions

    • Protein interaction network construction

  • Comparative genomics:

    • Evolutionary analysis of Bcen_6169 homologs across bacterial species

    • Identification of conserved domains and residues

    • Correlation of sequence variations with functional differences

The multi-dataset approach offers several advantages:

  • Reduction of platform-specific biases and technical noise

  • Higher confidence in identified functional relationships

  • Robust prioritization of hypotheses for experimental validation

When analyzing multi-layered data, Bayesian network models trained on simpler controlled systems typically demonstrate better performance than those trained on more complex biological systems. Using multiple independent datasets helps identify highly predictive and consistent genes that are likely fundamentally involved in the biological process under study .

What role might Bcen_6169 play in Burkholderia cenocepacia pathogenesis?

Burkholderia cenocepacia is an opportunistic pathogen associated with severe respiratory infections, particularly in cystic fibrosis patients. The potential role of Bcen_6169 in pathogenesis can be examined through several research approaches:

  • Virulence attenuation studies:

    • Construction of Bcen_6169 knockout mutants

    • Assessment of bacterial survival in macrophage infection models

    • Evaluation of biofilm formation capacity

    • Measurement of virulence in appropriate animal models

  • Host-pathogen interaction dynamics:

    • Examination of Bcen_6169 expression during different infection stages

    • Analysis of host immune response to wild-type versus Bcen_6169 mutants

    • Identification of host cellular proteins that interact with Bcen_6169

  • Structural basis for pathogenesis:

    • Investigation of conformational changes in Bcen_6169 under infection-relevant conditions

    • Examination of potential molecular mimicry with host proteins

    • Analysis of membrane dynamics mediated by Bcen_6169 during infection

Understanding Bcen_6169's role in pathogenesis could provide insights into bacterial adaptation strategies during infection and potentially identify new therapeutic targets for this difficult-to-treat pathogen .

How can contradictory data regarding Bcen_6169 function be reconciled in research contexts?

Addressing contradictory findings regarding Bcen_6169 function requires a systematic approach:

  • Experimental design analysis:

    • Detailed comparison of methodological differences between studies

    • Examination of bacterial strain differences (laboratory vs. clinical isolates)

    • Assessment of growth conditions and expression systems

    • Verification of protein construct integrity (full-length vs. truncated)

  • Data integration strategies:

    • Meta-analysis of quantitative data with appropriate statistical corrections

    • Weighted assessment based on methodological rigor and reproducibility

    • Contextualization within broader literature on septation proteins

    • Development of unified models that accommodate apparently conflicting data

  • Resolution through targeted experiments:

    • Design of decisive experiments addressing specific contradictions

    • Use of multiple complementary techniques to verify key findings

    • Collaboration between laboratories reporting different results

Researchers should consider that Bcen_6169 may have context-dependent functions that manifest differently under varying experimental conditions. Additionally, the protein might possess multiple functional domains with distinct activities that could explain seemingly contradictory observations .

What are the common challenges in working with recombinant Bcen_6169 and how can they be addressed?

ChallengeSolution ApproachScientific Rationale
Low expression yield1. Optimize codons for expression host
2. Lower induction temperature (16-18°C)
3. Test different E. coli strains (C41/C43)
4. Use auto-induction media
Addresses translation efficiency issues
Reduces protein aggregation
Strains specialized for toxic/membrane proteins
Gradual protein induction prevents toxicity
Protein insolubility1. Screen detergent panel (DDM, LDAO, etc.)
2. Include stabilizing agents (glycerol, specific lipids)
3. Test solubilization buffers with varying pH
Different detergents have varying efficiency
Mimics native membrane environment
pH affects protein-detergent interactions
Purification difficulties1. Use tandem affinity tags
2. Implement on-column refolding
3. Increase imidazole in wash steps
Increases specificity of purification
Recovers misfolded protein
Reduces non-specific binding
Protein instability1. Add protease inhibitors
2. Minimize freeze-thaw cycles
3. Store with glycerol at -80°C
Prevents degradation
Avoids denaturation
Stabilizes protein conformation

Addressing these challenges requires systematic optimization and potentially the use of specialized membrane protein expression systems such as cell-free systems or eukaryotic hosts for particularly difficult constructs .

How can researchers verify the structural integrity of purified Bcen_6169?

Verifying structural integrity of purified Bcen_6169 requires multiple complementary biophysical techniques:

  • Circular Dichroism (CD) Spectroscopy:

    • Assessment of secondary structure composition

    • Monitoring of thermal stability

    • Comparison with computational predictions

  • Tryptophan Fluorescence Spectroscopy:

    • Evaluation of tertiary structure integrity

    • Measurement of conformational changes upon ligand binding

    • Assessment of protein stability in different buffer conditions

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Determination of oligomeric state

    • Assessment of sample homogeneity

    • Detection of protein-detergent complexes

  • Negative Stain Electron Microscopy:

    • Visualization of protein particles

    • Confirmation of expected size and shape

    • Preliminary evaluation before more advanced structural studies

  • Limited Proteolysis:

    • Identification of accessible versus protected regions

    • Comparison with predicted domain organization

    • Assessment of proper folding

These approaches provide complementary information about different aspects of protein structure and should be used in combination to comprehensively evaluate structural integrity .

What emerging technologies could advance our understanding of Bcen_6169 function?

Several cutting-edge technologies show promise for elucidating Bcen_6169 function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural determination without crystallization

    • Visualization of membrane protein in near-native environment

    • Potential for capturing different functional states

  • AlphaFold2 and Related AI-Based Structure Prediction:

    • Accurate prediction of protein structure from sequence

    • Generation of testable structural hypotheses

    • Integration with experimental data for hybrid approaches

  • Native Mass Spectrometry:

    • Analysis of intact membrane protein complexes

    • Identification of binding partners and post-translational modifications

    • Determination of protein-lipid interactions

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET):

    • Real-time monitoring of conformational changes

    • Analysis of protein dynamics at single-molecule resolution

    • Investigation of transient interactions with other cellular components

  • CRISPR-Cas9 Base Editing:

    • Precise modification of specific residues without full gene deletion

    • Creation of targeted mutation libraries

    • Assessment of structure-function relationships in vivo

These technologies can provide unprecedented insights into the structural dynamics and functional interactions of Bcen_6169, particularly when used in complementary approaches that integrate structural, functional, and genomic data .

How might comparative genomics inform research on Bcen_6169 homologs across bacterial species?

Comparative genomics offers powerful approaches to understand Bcen_6169 evolution and function:

  • Phylogenetic profiling:

    • Identification of Bcen_6169 homologs across diverse bacterial species

    • Correlation of presence/absence patterns with phenotypic traits

    • Discovery of co-evolved gene clusters suggesting functional relationships

  • Sequence conservation analysis:

    • Identification of highly conserved residues indicative of functional importance

    • Detection of species-specific variations that may relate to pathogenic adaptations

    • Recognition of conserved protein domains and motifs

  • Synteny analysis:

    • Examination of gene neighborhood conservation across species

    • Identification of functionally related genes based on genomic organization

    • Detection of horizontal gene transfer events

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify regions under purifying or positive selection

    • Correlation of selection patterns with protein structural features

    • Identification of residues potentially involved in host-pathogen interactions

This comparative approach can reveal evolutionary constraints on Bcen_6169 function and identify conserved features that may represent essential functional elements, as well as variable regions that might contribute to species-specific adaptations .

What are the implications of Bcen_6169 research for understanding bacterial membrane dynamics?

Bcen_6169 research has broader implications for bacterial membrane biology:

  • Cell division mechanisms:

    • Insights into septation protein networks in pathogenic bacteria

    • Understanding of membrane remodeling during bacterial cell division

    • Elucidation of species-specific adaptations in division processes

  • Membrane protein biogenesis:

    • Models for membrane protein folding and assembly

    • Understanding of transmembrane domain interactions

    • Insights into protein-lipid interactions in bacterial membranes

  • Antibiotic development:

    • Identification of potential new targets for antimicrobial development

    • Understanding of membrane-associated resistance mechanisms

    • Structure-based drug design approaches targeting septation machinery

The advanced study of Bcen_6169 contributes to our fundamental understanding of bacterial cell biology while potentially opening new avenues for therapeutic intervention against Burkholderia infections, which are notoriously difficult to treat with conventional antibiotics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.