Recombinant Burkholderia cenocepacia Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant HtpX is typically expressed in Escherichia coli using plasmid systems, followed by affinity chromatography (e.g., His-tag purification). Commercial producers optimize storage in Tris-based buffers with 50% glycerol at -20°C or -80°C to maintain stability .

Research Applications

  • ELISA Development: Recombinant HtpX is used as an antigen in immunoassays to study antibody responses in infections .

  • Stress Response Studies: While direct functional data on B. cenocepacia HtpX is limited, homologs in E. coli and Bacillus subtilis regulate protein quality during heat or oxidative stress, suggesting analogous roles .

Genetic and Evolutionary Context

  • The htpX gene is conserved across Burkholderia species. In B. cenocepacia, it resides in a genomic region with genes linked to oxidative stress adaptation and metal metabolism .

  • Evolutionary analyses of B. cenocepacia isolates from cystic fibrosis patients highlight mutations in stress-response regulators, though htpX itself was not reported as a mutational hotspot .

Future Directions

Functional studies are needed to clarify HtpX’s role in B. cenocepacia pathogenicity. CRISPR-Cas systems (e.g., RhaCAST ) could enable targeted mutagenesis to explore its contributions to stress survival or host interactions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
htpX; Bcen2424_3124; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFSYWFSDKMVLRMYNAQ EVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTITATMAGAISALANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQSLATALDKIHRYAAGIPFQAAEA HPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMARTGRFE
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the HtpX protease and what protein family does it belong to?

HtpX is a membrane-bound zinc metalloprotease that belongs to the M48 family of proteases. It functions in the proteolytic quality control of membrane proteins, preventing accumulation of misfolded proteins that could disturb membrane structure and function. The M48 family is characterized by a single catalytic zinc ion tetrahedrally coordinated by two histidines within a conserved HEXXH motif. HtpX plays a central role in maintaining cellular homeostasis by eliminating defective membrane proteins that could compromise normal cellular activities .

What is the genomic context of HtpX in Burkholderia cenocepacia?

In Burkholderia cenocepacia, HtpX (designated as BCAL2829) is part of a six-gene cluster located on chromosome 1. This gene cluster encodes a two-component regulatory system (BCAL2831 and BCAL2830) along with HtpX protease (BCAL2829). Reverse transcriptase PCR analysis has confirmed that these six genes are co-transcribed and comprise an operon. This genomic arrangement suggests coordinated regulation of these genes in response to environmental stressors .

What cellular compartment does the HtpX protease localize to and why is this significant?

The HtpX protease in Burkholderia cenocepacia localizes to the periplasmic compartment, as demonstrated through Western blot analysis and colicin V reporter assays. This localization is functionally significant because it positions HtpX at the interface between the external environment and the cytoplasm, allowing it to respond to extracellular stresses and protect the cell by degrading damaged membrane proteins. The periplasmic positioning enables HtpX to participate in the first line of cellular defense against environmental stressors .

What stress conditions require functional HtpX for bacterial survival?

Genetic analyses and complementation studies have revealed that HtpX in Burkholderia cenocepacia is essential for bacterial growth under specific stress conditions. These include:

  • Osmotic stress: Growth under high salt concentrations (NaCl or KCl)

  • Thermal stress: Growth at elevated temperatures (44°C)

The requirement for HtpX under these conditions indicates its critical role in stress adaptation mechanisms. Additionally, in vivo experiments using the rat agar bead model of chronic lung infection demonstrated that inactivation of the htrA gene is associated with a bacterial survival defect, suggesting HtpX functions as a virulence factor in B. cenocepacia .

How does the structure of HtpX relate to its function in protein quality control?

HtpX is an integral membrane protein with multiple hydrophobic regions that likely function as transmembrane segments. These structural features allow HtpX to interact with and recognize misfolded membrane proteins.

Key structural elements that contribute to function include:

  • The catalytic zinc-binding HEXXH motif essential for proteolytic activity

  • Multiple hydrophobic regions (H1-H4) that anchor the protein in the membrane

  • Specific domains that recognize misfolded proteins

The structure-function relationship enables HtpX to identify and cleave aberrant membrane proteins, preventing their accumulation and potential toxicity. Computational studies of HtpX homologs reveal conserved residues that likely participate in substrate recognition and catalytic activity .

What is the biochemical mechanism of HtpX protease activity?

HtpX functions as a zinc-dependent metalloprotease with an endopeptidase activity. The catalytic mechanism involves:

  • Coordination of a zinc ion by the conserved HEXXH motif

  • Zinc-activated water molecule acting as the nucleophile in peptide bond hydrolysis

  • Recognition of specific substrate sequences or conformations associated with misfolded proteins

The protease exhibits optimal activity at pH 7.4 and 37°C, though it maintains significant activity at temperatures up to 45-50°C. This temperature range correlates with its role in heat shock response. The serine residue in the active site and PDZ domains are essential for proper function, as demonstrated by mutagenesis studies where replacement of the serine residue with alanine (S245A) or deletion of PDZ domains resulted in loss of protein function .

What expression systems have proven effective for recombinant HtpX production?

Several expression systems have been successfully employed for recombinant HtpX production, with key considerations to overcome the inherent toxicity of these proteases to host cells:

Expression SystemVectorHostTagsNotable Features
pET-derived systempET with C-terminal His8-tagE. coli BL21(DE3)C-terminal His8-tagEffective for purification using cobalt-affinity chromatography
pT7 systempT7E. coliNot specifiedOptimization required to increase yield and solubility
pHT43 systempHT43E. coli BL21 (DE3), B. subtilis WB800NNot specifiedShown to increase fermentation level 61.9-fold compared to wild-type protease

The choice of expression system depends on research objectives, with the pET system offering good yields for structural studies, while the pHT43 system has demonstrated superior performance for activity studies .

What are the critical steps for successful purification of active HtpX protease?

Purification of active HtpX protease requires careful attention to several critical steps:

  • Membrane extraction: Effective solubilization using appropriate detergents such as octyl-β-d-glucoside is essential, as HtpX is a membrane-integrated protein.

  • Chromatography sequence:

    • Primary purification using metal affinity chromatography (cobalt-affinity)

    • Secondary purification via ion-exchange chromatography (anion-exchange)

    • Final polishing step using size-exclusion chromatography

  • Refolding protocols: When expressed in inclusion bodies, improved refolding procedures are necessary to obtain the protease in an active and stable form.

  • Activity preservation: Maintaining appropriate buffer conditions (pH 7.4) and temperature control is crucial to preserve proteolytic activity throughout purification.

Adherence to these methodological steps has been shown to yield near-homogeneous preparations of active HtpX protease suitable for biochemical and structural studies .

How can researchers overcome the challenges associated with HtpX toxicity during expression?

HtpX proteases are generally toxic to cells, making their expression challenging. Researchers can employ several strategies to mitigate this toxicity:

  • Catalytically inactive mutants: Expression of HtpX variants with mutations in the active site (e.g., S245A) or zinc-binding motif can reduce toxicity while maintaining structural integrity.

  • Inducible expression systems: Tight control of expression using IPTG-inducible promoters allows for cell growth prior to protein production.

  • Compartmentalization: Directing the protein to inclusion bodies through high expression rates can sequester the toxic protease from cellular components.

  • Specialized host strains: Using E. coli BL21(DE3) or B. subtilis WB800N, which are more tolerant to toxic proteins.

  • Co-expression with chaperones: This approach can improve folding and reduce aggregation-related toxicity.

These strategies have been successfully implemented to achieve sufficient yields of recombinant HtpX for functional and structural characterization .

What in vivo assay systems are available for measuring HtpX protease activity?

Researchers have developed several in vivo assay systems for measuring HtpX activity:

  • Model substrate approach: An in vivo semiquantitative and convenient protease activity assay system has been established using a constructed model substrate for HtpX. This system enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions .

  • Zymography analysis: This technique allows visualization of proteolytic activity directly in polyacrylamide gels, as demonstrated with gut protein samples containing HtpX-like proteases .

  • Growth under stress conditions: Measuring bacterial growth under osmotic or thermal stress conditions serves as a functional assay for HtpX activity, as strains lacking functional HtpX show growth defects under these conditions .

  • Casein hydrolysis assays: These provide a quantitative measure of general proteolytic activity that can be applied to purified HtpX preparations .

These complementary approaches provide researchers with tools to investigate HtpX function in various experimental contexts .

How can researchers analyze the substrate specificity of HtpX proteases?

Analyzing substrate specificity of HtpX proteases requires a multi-faceted approach:

  • Model substrate engineering: Construction of model substrates with systematic variations in potential cleavage sites allows mapping of sequence preferences. The established model substrate system for HtpX can be modified to incorporate different target sequences .

  • Proteomic approaches: Mass spectrometry-based identification of cleavage products from complex protein mixtures can reveal natural substrates and preferred cleavage motifs.

  • In silico analysis: Computational prediction of substrate binding using tools like CASTpFold (http://sts.bioe.uic.edu/castp/index.html) can identify potential binding pockets and interactions with substrates .

  • Site-directed mutagenesis: Systematic alteration of residues in the active site or substrate-binding regions can reveal their contribution to specificity.

  • Structural analysis: Techniques such as AlphaFold3 for tertiary structure prediction combined with binding site analysis provide insights into the structural basis of substrate recognition .

These approaches collectively enable detailed characterization of HtpX substrate preferences and mechanisms .

What molecular techniques are essential for characterizing HtpX gene function in bacterial pathogens?

Several molecular techniques are essential for comprehensive characterization of HtpX function:

  • Gene knockout and complementation: Insertional inactivation using suicide plasmids (e.g., pGPOmegaTp) followed by phenotypic analysis and genetic complementation to confirm gene-function relationships .

  • Site-directed mutagenesis: Targeted modification of key residues (e.g., S245A mutation in the active site) to assess their contribution to enzyme function .

  • Domain deletion analysis: Removal of specific protein domains (e.g., PDZ domains) to determine their role in protein activity .

  • Subcellular localization studies: Western blot analysis and reporter assays (e.g., colicin V reporter) to determine the cellular compartment where HtpX functions .

  • Reverse transcriptase PCR: Analysis of gene expression and operon structure to understand regulatory context .

  • In vivo infection models: Animal models (e.g., rat agar bead model of chronic lung infection) to assess the contribution of HtpX to virulence and pathogenesis .

These techniques provide a comprehensive toolkit for investigating the molecular basis of HtpX function in bacterial pathogenesis and stress response .

How does HtpX contribute to bacterial pathogenesis and virulence mechanisms?

HtpX contributes to bacterial pathogenesis through several mechanisms:

  • Stress adaptation: HtpX enables bacterial survival under host-imposed stresses, including osmotic and thermal stress conditions encountered during infection. This adaptation is critical for persistent infection, as demonstrated in B. cenocepacia where HtpX is required for growth under these stress conditions .

  • Virulence factor activity: In vivo studies using the rat agar bead model of chronic lung infection have demonstrated that inactivation of the htrA gene in B. cenocepacia is associated with a bacterial survival defect, directly implicating HtpX as a virulence factor .

  • Membrane protein quality control: By preventing accumulation of misfolded membrane proteins, HtpX maintains bacterial membrane integrity under the hostile conditions of the host environment .

  • Association with endodontic infections: Computational proteomic studies have linked HtpX homologs with endodontic infections, suggesting a role in dental pathogenesis .

Understanding these mechanisms provides potential targets for therapeutic intervention to combat bacterial infections, particularly in vulnerable populations such as cystic fibrosis patients where B. cenocepacia poses a serious threat .

What evolutionary insights can be gained from comparative analysis of HtpX homologs across bacterial species?

Comparative analysis of HtpX homologs reveals important evolutionary insights:

  • Phylogenetic relationships: Molecular phylogenetic analysis using tools like MEGA11 has identified ancestral relationships among bacterial species carrying HtpX homologs. For instance, Polynucleobacter necessarius appears to be ancestral to several other organisms with HtpX homologs, suggesting they might share common pathogenic strategies .

  • Conserved domains: Multiple sequence alignment reveals highly conserved regions across species, particularly in the catalytic domains. Computational analysis has identified 19 conserved and exposed residues, along with 38 conserved and buried residues, highlighting functional constraints on evolution .

  • Structural conservation: Despite sequence variations, the tertiary structure predictions show conservation of key structural elements, particularly in the zinc-binding motif and active site configuration.

  • Adaptive variations: Differences in protein length (ranging from 279 to 336 amino acids) and physicochemical properties suggest species-specific adaptations to different ecological niches .

These evolutionary insights contribute to our understanding of bacterial adaptation and may inform strategies for broad-spectrum antimicrobial development .

What role does HtpX play in bacterial stress response networks and how is it regulated?

HtpX functions within complex stress response networks with sophisticated regulation:

  • Operon organization: In B. cenocepacia, HtpX is part of a six-gene operon that includes a two-component regulatory system (BCAL2831 and BCAL2830), indicating coordinated expression with other stress response elements .

  • Protein-protein interactions: Interaction analysis through STRING reveals that HtpX functionally interacts with multiple partners. For instance, in Polynucleobacter necessarius, htpX interacts with def, Pnec_1775, fmt, Pnec_1774, Pnec_1773, Pec_1772, ftsH, Pnec_1779, Pnec_1611, and grpE .

  • Pathway integration: HtpX participates in protein quality control pathways, complementing other proteolytic systems. This integration ensures redundancy and robustness in stress response mechanisms .

  • Temperature-dependent regulation: The ability of HtpX to maintain significant activity at elevated temperatures (45-50°C) suggests its regulation is tied to heat shock response systems .

  • Metal ion modulation: The binding of Ca²⁺ to recombinant HtpX protease has been shown to result in the formation of the largest active pocket, suggesting metal ions may regulate activity in vivo .

Understanding these regulatory mechanisms provides insights into bacterial adaptation to environmental stresses and potential avenues for therapeutic intervention .

How might computational proteomics advance our understanding of HtpX structure-function relationships?

Computational proteomics offers powerful approaches to illuminate HtpX structure-function relationships:

  • Structure prediction: Advanced tools like AlphaFold3 can predict the tertiary structure of HtpX with increasing accuracy, providing insights into the spatial arrangement of catalytic residues and substrate-binding pockets .

  • Binding pocket analysis: Tools such as CASTpFold can analyze protein pockets and their binding to metal ions, revealing how structural features contribute to catalytic activity. For instance, binding of Ca²⁺ to HtpX has been shown to influence the size of the active pocket .

  • Conservation analysis: Per-site evolutionary rate estimation using ConSurf can identify functionally critical residues based on their conservation across species. Studies have identified both conserved exposed residues (likely involved in interactions) and conserved buried residues (likely critical for structural integrity) .

  • Molecular dynamics simulations: These can reveal conformational changes during substrate binding and catalysis, providing insights into the dynamic aspects of HtpX function.

  • Virtual screening: Computational docking of potential substrates or inhibitors can predict interactions and guide experimental design for investigating specificity and developing targeted inhibitors.

These computational approaches complement experimental methods and accelerate our understanding of HtpX function .

What therapeutic potential exists in targeting HtpX proteases in bacterial pathogens?

The therapeutic potential of targeting HtpX proteases stems from several key observations:

  • Role in virulence: HtpX has been demonstrated to be a virulence factor in B. cenocepacia, with inactivation resulting in reduced bacterial survival in vivo .

  • Requirement for stress adaptation: HtpX is essential for bacterial growth under osmotic and thermal stress conditions encountered during infection .

  • Structural distinctiveness: As a membrane-integrated zinc metalloprotease, HtpX presents unique structural features that could be exploited for selective targeting.

  • Conserved catalytic mechanism: The conserved zinc-binding HEXXH motif provides a specific target for inhibitor design.

Potential therapeutic approaches include:

  • Small molecule inhibitors: Designed to interact with the catalytic zinc or active site residues

  • Peptide-based inhibitors: Mimicking substrate binding but resistant to proteolysis

  • Allosteric modulators: Targeting non-catalytic regions to alter protein dynamics

  • Antisense oligonucleotides: Reducing HtpX expression at the mRNA level

Given the rising concern of antibiotic resistance, novel targets like HtpX offer promising avenues for antimicrobial development, particularly for difficult-to-treat infections like those caused by B. cenocepacia in cystic fibrosis patients .

What methodological innovations might improve research on membrane-integrated proteases like HtpX?

Several methodological innovations show promise for advancing research on membrane-integrated proteases:

  • Nanodiscs and synthetic membrane systems: These provide more native-like environments for studying membrane proteins, potentially improving activity and stability of purified HtpX for structural and functional studies.

  • Cryo-electron microscopy: This technique is increasingly capable of resolving membrane protein structures at near-atomic resolution, potentially overcoming challenges in crystallizing membrane proteases like HtpX.

  • Advanced model substrate designs: Building on existing model substrate approaches , more sophisticated reporter systems could provide real-time, in vivo monitoring of HtpX activity.

  • Native mass spectrometry: This emerging technique allows analysis of membrane proteins with bound lipids and detergents, providing insights into how the membrane environment influences HtpX structure and function.

  • Gene editing approaches: CRISPR-Cas9 and related technologies enable more precise genetic manipulation to study HtpX function in its native context.

  • Single-molecule techniques: These methods could reveal the dynamics of substrate recognition and processing by individual HtpX molecules in membrane environments.

These methodological innovations have the potential to overcome current limitations in studying membrane proteases and accelerate progress in understanding HtpX function and applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.