Recombinant Burkholderia cenocepacia Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia cenocepacia Protein CrcB Homolog (CrcB)

Recombinant Burkholderia cenocepacia Protein CrcB homolog (crcB) is a genetically engineered protein derived from the fluoride ion transporter CrcB of the opportunistic pathogen B. cenocepacia. This protein is expressed in Escherichia coli with an N-terminal His-tag for purification and functional studies. CrcB homologs are implicated in bacterial stress responses, particularly resistance to fluoride ions, which are toxic to microbial cells .

Primary Structure

The recombinant CrcB protein consists of 128 amino acids (UniProt ID: Q1BYC6) with the sequence:
MFYSIVAIFVGAGLGALLRWFLSLALNAFFPAVPLGTLASNLIGGYVIGVAAVVFTVRVGLPPEWRLFVITGFLGGLTTFSTYSVEVMTHALEGEFGWALAVAALHLTGSFALTALGMWTARAWLAAA .

Domain Features

CrcB belongs to the CrcB superfamily (Pfam: PF04389), characterized by six transmembrane helices. Structural predictions suggest its role in fluoride ion transport or efflux, though experimental validation in B. cenocepacia remains limited .

Production and Purification

ParameterDetails
Expression SystemEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water; glycerol (5–50%) recommended for long-term stability
Data derived from recombinant production specifications .

Functional Insights from Homologs

While direct studies on B. cenocepacia CrcB are sparse, homologs in other bacteria provide mechanistic clues:

  • Fluoride Resistance: E. coli CrcB mediates fluoride efflux via proton antiport, enabling survival in high-fluoride environments .

  • Stress Adaptation: CrcB-like proteins in Pseudomonas aeruginosa regulate biofilm formation under oxidative stress, suggesting a potential role in B. cenocepacia virulence .

Research Implications

The recombinant CrcB protein serves as a tool to investigate:

  1. Ion Transport Mechanisms: Fluoride efflux pathways in Burkholderia species.

  2. Pathogen Survival: Contributions to persistence in cystic fibrosis lungs, where fluoride concentrations fluctuate.

  3. Antimicrobial Targets: Potential for disrupting ion homeostasis to combat multidrug-resistant B. cenocepacia infections .

Limitations and Future Directions

Current knowledge gaps include:

  • In vivo Function: Lack of studies linking CrcB to B. cenocepacia pathogenicity.

  • Structural Resolution: No crystallographic data to confirm transport mechanisms.
    Future work should prioritize functional assays in B. cenocepacia infection models and structural analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your needs.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple use to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag preference, please communicate it to us and we will prioritize developing the specified tag.
Synonyms
crcB; Bcenmc03_0908; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain MC0-3)
Target Names
crcB
Target Protein Sequence
MFYSIVAIFVGAGLGALLRWFLSLALNAFFPAVPLGTLASNLIGGYVIGVAAVVFTVRVG LPPEWRLFVITGFLGGLTTFSTYSVEVMTHALEGEFGWALAVAALHLTGSFALTALGMWT ARAWLAVA
Uniprot No.

Target Background

Function
CrcB plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxic effects.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How are CrcB homologs identified in bacterial genomes like Burkholderia cenocepacia?

CrcB homologs are typically identified through computational genomic analysis using:

  • Hidden Markov Models (HMMs): Researchers use the CrcB-like protein Camphor Resistance (CrcB) HMM with a gathering threshold of 32.9, as demonstrated in studies of Pseudomonas species .

  • Sequence similarity searches: Tools like hmmsearch 3.1b2 are employed to determine the significance of potential matches in the genome .

  • Pairwise BLAST analysis: This method helps determine percent identities between identified putative CrcB sequences and established reference sequences .

For B. cenocepacia specifically, researchers would likely align potential sequences against well-characterized CrcB proteins from related organisms, such as P. putida ATCC 12633, which has been used as a reference for identifying CrcB homologs in other species .

What experimental methods are used to validate and characterize CrcB function in bacteria?

Functional validation of CrcB proteins typically employs these methodologies:

  • Gene knockout/complementation studies: Creating conditional mutants (as demonstrated with other essential proteins in B. cenocepacia) where gene expression is placed under a controlled promoter (e.g., rhamnose-inducible) .

  • Phenotypic characterization: Observing cellular morphology and viability under depletion conditions, similar to studies with MurJ in B. cenocepacia .

  • Fluoride sensitivity assays: Measuring bacterial growth in media containing varying concentrations of fluoride to assess CrcB function in fluoride resistance.

  • Membrane protein localization: Using fluorescent protein fusions or epitope tags to confirm membrane localization of CrcB.

  • Complementation with homologs: Testing functional conservation by expressing CrcB homologs from other bacterial species, similar to the reciprocal complementation approach used with MurJ between B. cenocepacia and E. coli .

How does the structure of Burkholderia cenocepacia CrcB homolog compare to other bacterial CrcB proteins, and what functional implications do these structural differences suggest?

While the specific structure of B. cenocepacia CrcB has not been fully characterized in the literature provided, comparative structural analysis would typically involve:

  • Computational structural prediction: Using tools like AlphaFold or homology modeling based on crystallized CrcB structures from other bacteria.

  • Sequence alignment analysis: Comparing conserved domains and motifs across various bacterial species, identifying B. cenocepacia-specific variations that might relate to function.

  • Transmembrane topology prediction: CrcB proteins generally contain multiple transmembrane domains that form ion channels.

Functional implications from structural differences could involve:

  • Altered ion selectivity or conductance

  • Different regulatory mechanisms

  • Varied interactions with other membrane components

  • Adaptations specific to B. cenocepacia's environmental niches

The identification of CrcB homologs in Pseudomonas species showed varying degrees of sequence identity compared to reference strains , suggesting potential functional variations across bacterial species that would be worthy of investigation in B. cenocepacia.

What role might CrcB play in the adaptation and persistence of Burkholderia cenocepacia during chronic infections in cystic fibrosis patients?

B. cenocepacia is known to undergo significant adaptive evolution during chronic cystic fibrosis (CF) infections, with bacteria accumulating mutations at a rate of approximately 2.08 SNPs/year . While CrcB specifically isn't mentioned in the adaptation studies, several patterns of bacterial evolution in the CF lung environment could implicate CrcB function:

  • Oxidative stress response: CF lungs present a high-oxidative stress environment, and B. cenocepacia accumulates mutations in genes associated with oxidative stress response . If CrcB contributes to membrane integrity or ion homeostasis, it may play a role in this adaptive response.

  • Metal ion homeostasis: Genes related to transition metal metabolism are hotspots for nucleotide polymorphism in B. cenocepacia during CF infections . As an ion channel protein, CrcB might intersect with these pathways.

  • Environmental adaptation: Two orthologous genes shared by B. cenocepacia and B. multivorans were found to be under strong selection during CF infection, including a nucleotide sugar dehydratase involved in lipopolysaccharide O-antigen biosynthesis and a two-component regulatory sensor kinase . This suggests membrane components and sensing systems are critical for adaptation, potentially implicating membrane proteins like CrcB.

  • Antibiotic resistance: B. cenocepacia evolves mechanisms against antibiotics during chronic infections . CrcB's role in membrane function could potentially influence antibiotic uptake or efflux.

What methodological approaches would you recommend for producing and purifying recombinant Burkholderia cenocepacia CrcB protein for structural studies?

For successful production and purification of recombinant B. cenocepacia CrcB, I recommend this methodological workflow:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains specialized for membrane protein expression

    • Alternative systems like Pichia pastoris for eukaryotic-like post-translational modifications if needed

  • Vector design considerations:

    • Inclusion of affinity tags (His6, FLAG, or MBP) for purification

    • Fusion to GFP for expression monitoring and proper folding assessment

    • Incorporation of a precision protease cleavage site for tag removal

  • Expression optimization:

    • Temperature modulation (typically 16-20°C for membrane proteins)

    • Induction parameter testing (IPTG concentration 0.1-1.0 mM)

    • Testing various media formulations (TB, LB, minimal media with supplements)

  • Extraction protocol:

    • Membrane fraction isolation through differential centrifugation

    • Gentle solubilization using detergents appropriate for ion channels:

DetergentCritical Micelle Concentration (mM)AdvantagesConsiderations
DDM0.17Mild, widely usedLarge micelles
LMNG0.01High stabilityExpensive
Digitonin0.5Native-like environmentNatural source variability
SMA copolymerN/APreserves lipid environmentpH limitations
  • Purification strategy:

    • IMAC (immobilized metal affinity chromatography) as initial capture step

    • Size exclusion chromatography for final polishing and buffer exchange

    • Optional ion exchange chromatography if higher purity is required

  • Functional validation:

    • Liposome reconstitution and ion flux assays

    • Fluoride binding assays

    • Thermostability assessment using differential scanning fluorimetry

This approach builds on methodology similar to that used in other bacterial membrane protein studies, adapted for the specific challenges of CrcB as an ion channel protein.

How can researchers design experiments to investigate potential interactions between CrcB and other membrane proteins in Burkholderia cenocepacia?

To investigate protein-protein interactions involving the CrcB homolog in B. cenocepacia, researchers should consider these methodological approaches:

  • In vivo protein-protein interaction methods:

    • Bacterial two-hybrid system: Optimized for membrane proteins using split ubiquitin or adenylate cyclase-based systems

    • Förster Resonance Energy Transfer (FRET): Using fluorescent protein fusions to detect proximity between CrcB and potential partners

    • Bimolecular Fluorescence Complementation (BiFC): Particularly useful for validating interactions in the native cellular environment

  • Co-immunoprecipitation approaches:

    • Epitope tagging of CrcB (ensuring tag placement doesn't interfere with function)

    • Crosslinking prior to solubilization to capture transient interactions

    • Mass spectrometry analysis of co-precipitated proteins

  • Proximity labeling techniques:

    • BioID or TurboID fusion to CrcB for biotinylation of proximal proteins

    • APEX2 fusion for peroxidase-based proximity labeling

    • Analysis of labeled proteins via streptavidin pulldown and mass spectrometry

  • Genetic interaction screening:

    • Synthetic genetic array analysis with conditional CrcB mutants

    • Transposon insertion sequencing (Tn-Seq) in CrcB-depleted backgrounds

    • Suppressor screens to identify genes that mitigate CrcB depletion phenotypes

  • Functional correlation analysis:

    • Comparative phenotyping of CrcB mutants with other membrane protein mutants

    • Lipidomic analysis to identify lipid compositional changes that might affect multiple membrane proteins including CrcB

When interpreting results, researchers should account for artificial interactions that may arise due to membrane protein overexpression or tag interference, validating key findings through multiple independent methods.

What experimental approaches would you recommend to investigate the role of CrcB in fluoride resistance in Burkholderia cenocepacia, particularly in the context of clinical isolates?

To investigate CrcB's role in fluoride resistance in B. cenocepacia clinical isolates, I recommend this comprehensive experimental framework:

  • Genetic characterization:

    • Sequence analysis of crcB across clinical isolates to identify natural variants

    • Correlation of sequence variations with patient data, infection chronicity, and treatment history

    • Creation of conditional crcB mutants using rhamnose-inducible promoters as demonstrated with other essential genes in B. cenocepacia

  • Phenotypic assessment:

    • Minimal inhibitory concentration (MIC) determination for fluoride in various clinical isolates

    • Growth curve analysis under fluoride stress conditions

    • Viability assessment using live/dead staining during fluoride exposure

    • Complementation studies with wild-type crcB to confirm phenotype specificity

  • Fluoride transport measurement:

    • Use of fluoride-sensitive electrodes to measure intracellular vs. extracellular fluoride concentrations

    • Fluoride ion flux assays in membrane vesicles prepared from wild-type and crcB-depleted cells

    • Radiolabeled or fluorescent fluoride analog uptake/efflux studies

  • Physiological impact assessment:

    • Transcriptomic analysis comparing wild-type and crcB-depleted cells with and without fluoride stress

    • Metabolomic profiling to identify affected pathways

    • Membrane integrity assessment using fluorescent dyes and microscopy

  • Clinical relevance investigation:

    • Comparison of fluoride resistance between isolates from early infection vs. chronic infection stages

    • Analysis of crcB expression levels in different infection environments

    • Correlation between fluoride resistance and antibiotic susceptibility profiles

This approach combines genetic, biochemical, and physiological methods to comprehensively characterize CrcB's role in fluoride resistance and its potential significance in clinical contexts.

What are the key considerations for designing conditional knockout systems to study the CrcB homolog in Burkholderia cenocepacia?

Designing effective conditional knockout systems for studying potentially essential genes like crcB in B. cenocepacia requires careful methodological planning:

  • Promoter selection:

    • The rhamnose-inducible promoter (Prha) has been successfully used in B. cenocepacia for conditional gene expression, as demonstrated with murJ

    • Ensure tight regulation with minimal leakiness under non-inducing conditions

    • Confirm that the promoter remains functional in the infection models or conditions being studied

  • Integration strategy:

    • Homologous recombination to replace the native promoter with the inducible system

    • Retention of the native ribosome binding site to maintain translation efficiency

    • Inclusion of verification markers (e.g., antibiotic resistance) for selection

  • Verification methods:

    • PCR confirmation of correct integration

    • Sequencing across junction regions

    • RT-qPCR to confirm conditional expression

    • Western blotting (if antibodies available) to verify protein levels

  • Control considerations:

    • Construction of parallel strains with non-essential genes under the same promoter

    • Wild-type controls grown under identical conditions with and without inducer

    • Complementation controls with the wild-type gene on a plasmid

  • Phenotypic analysis parameters:

    • Establish clear timepoints for analysis after inducer withdrawal

    • Monitor growth rate, cell morphology, and viability at multiple timepoints

    • Include controls for potential metabolic effects of the inducer itself

  • Potential challenges:

    • B. cenocepacia possesses multiple chromosomes and may have compensatory genes

    • The unique cell wall structure of B. cenocepacia might affect phenotype manifestation

    • Clinical isolates may exhibit variable responses compared to reference strains

When implementing this approach, researchers should be aware that B. cenocepacia stopped growing and displayed morphological abnormalities under depletion conditions of another essential gene (murJ), eventually undergoing cell lysis , which provides a precedent for the expected phenotype if crcB is similarly essential.

How can researchers differentiate between direct and indirect effects when studying the phenotype of CrcB depletion in Burkholderia cenocepacia?

Differentiating direct from indirect effects in CrcB depletion studies requires a multi-faceted experimental approach:

  • Temporal analysis of phenotypic changes:

    • Establish a detailed time course of events following CrcB depletion

    • Primary (direct) effects typically manifest earlier than secondary consequences

    • Quantitative measurements at multiple time points can reveal the sequence of cellular changes

  • Complementation strategies:

    • Rapid restoration of CrcB expression to determine which phenotypes are immediately rescued

    • Use of CrcB homologs from other species with varying functional properties

    • Domain-specific mutations to correlate specific CrcB functions with observed phenotypes

  • Biochemical validation approaches:

    • Direct measurement of the presumed primary function (fluoride transport)

    • Assessment of membrane potential and other ion gradients

    • Lipidomic and metabolomic profiling to identify immediate biochemical changes

  • Suppressor mutant analysis:

    • Identification of spontaneous or engineered mutations that mitigate CrcB depletion phenotypes

    • Characterization of suppressor pathways can reveal direct vs. compensatory mechanisms

    • Rational targeting of related pathways to test specific hypotheses

  • Systems biology approaches:

    • Time-resolved transcriptomics and proteomics following CrcB depletion

    • Network analysis to distinguish primary response pathways from downstream effects

    • Correlation of expression patterns with known stress responses

  • Methodological controls:

    • Comparison with depletion of other membrane proteins (specificity control)

    • Partial depletion studies to identify dose-dependent effects

    • Parallel analysis under various environmental conditions to distinguish context-dependent effects

This systematic approach helps researchers build a model of causality rather than simply cataloging phenotypic changes associated with CrcB depletion.

What bioinformatic workflows would you recommend for identifying potential functional partners of CrcB in Burkholderia cenocepacia?

For identifying potential functional partners of CrcB in B. cenocepacia, I recommend this comprehensive bioinformatic workflow:

  • Co-evolution analysis:

    • Profile Hidden Markov Model (HMM) searches to identify CrcB homologs across diverse bacterial species

    • Phylogenetic profiling to identify genes with similar evolutionary distribution patterns

    • Mirror tree analysis to detect proteins with similar evolutionary rates across species

  • Genomic context analysis:

    • Examination of gene neighborhood conservation across related species

    • Identification of conserved operons or gene clusters containing crcB

    • Analysis of shared transcriptional regulation using motif discovery tools

  • Protein-protein interaction prediction:

    • Structural modeling of CrcB using AlphaFold or similar tools

    • Protein-protein docking simulations with candidate partners

    • Interface residue conservation analysis across homologs

  • Functional association networks:

    • Text mining of scientific literature for co-mentioned proteins

    • Integration of data from STRING and similar databases

    • Analysis of co-expression patterns across different conditions

  • Comparative analysis with model organisms:

    • Leveraging known functional partners of CrcB in better-studied bacteria like Pseudomonas

    • Ortholog mapping between model organisms and B. cenocepacia

    • Integration of experimental data from related bacterial systems

Analysis TypeKey ToolsExpected OutcomesValidation Approach
Sequence-basedHMMER, BLASTp, InterProScanHomology relationshipsSequence conservation metrics
Structure-basedAlphaFold, HADDOCK, PyMOL3D interaction modelsEnergy minimization scores
Network-basedSTRING, Cytoscape, WGCNAFunctional association networksCluster analysis statistics
Genomic contextMicrobesOnline, IMG/MConserved operonsPhylogenetic distribution

This integrated approach leverages diverse computational methods to generate testable hypotheses about CrcB's functional partners, which can then be validated experimentally.

How might studying CrcB contribute to understanding the adaptation of Burkholderia cenocepacia in diverse environments, particularly in cystic fibrosis infections?

Studying CrcB could significantly advance our understanding of B. cenocepacia adaptation through these research directions:

  • Environmental stress adaptation:

    • CrcB's role in fluoride resistance may extend to other halide ions or stress conditions relevant to CF lungs

    • Investigation of how CrcB expression and function changes during the transition from environmental to host niches

    • Examination of CrcB's potential contribution to the documented oxidative stress responses in CF infections

  • Evolution during chronic infection:

    • Sequence analysis of crcB across longitudinal clinical isolates to identify selective pressures

    • Comparison with the documented evolution rates of 2.08 SNPs/year observed in B. cenocepacia during CF infections

    • Assessment of whether crcB mutations correlate with other adaptive changes in membrane components

  • Biofilm formation and persistence:

    • Potential role of CrcB in maintaining ion homeostasis within biofilm structures

    • Investigation of CrcB's contribution to the transition between planktonic and biofilm lifestyles

    • Correlation between CrcB function and antibiotic tolerance in biofilms

  • Host-pathogen interactions:

    • CrcB's potential role in responding to host defense mechanisms, particularly those involving antimicrobial peptides or oxidative stress

    • Investigation of whether CrcB affects cell surface properties that modulate host immune recognition

    • Potential connection to the documented adaptation to low oxygen and iron concentrations in CF infections

  • Therapeutic implications:

    • Assessment of CrcB as a potential drug target, particularly if it proves essential under infection-relevant conditions

    • Investigation of potential synergies between CrcB inhibition and existing antibiotics

    • Development of fluoride-based combination therapeutics that might leverage CrcB function

This research would connect the molecular function of CrcB to the broader ecological and clinical contexts of B. cenocepacia infections, potentially revealing new therapeutic approaches for this challenging pathogen.

What role might CrcB play in the antibiotic resistance mechanisms of Burkholderia cenocepacia, and how could this be experimentally investigated?

The potential role of CrcB in antibiotic resistance mechanisms of B. cenocepacia could be investigated through these experimental approaches:

  • Antibiotic susceptibility profiling:

    • Determination of minimum inhibitory concentrations (MICs) for various antibiotic classes in wild-type vs. CrcB-depleted strains

    • Time-kill kinetics to assess rate of bacterial death under antibiotic pressure

    • Biofilm antibiotic tolerance assessment to evaluate CrcB's role in structured communities

  • Membrane permeability studies:

    • Fluorescent dye uptake assays (e.g., SYTOX Green, propidium iodide) to assess membrane integrity

    • Measurement of antibiotic accumulation using radiolabeled or fluorescent antibiotics

    • Assessment of membrane potential using voltage-sensitive dyes

  • Genetic interaction studies:

    • Construction of double mutants combining CrcB depletion with known resistance determinants

    • Transposon mutagenesis screens in CrcB-depleted backgrounds to identify synthetic lethal interactions

    • Overexpression of CrcB to determine if it enhances resistance to specific antibiotics

  • Molecular mechanism investigation:

    • Transcriptomic and proteomic profiling to identify changes in expression of known resistance genes upon CrcB depletion

    • Assessment of cell wall composition changes, given that B. cenocepacia with depleted essential proteins (e.g., MurJ) showed increased sensitivity to β-lactam antibiotics

    • Investigation of potential effects on efflux pump activity through functional assays

  • Clinical correlation studies:

    • Analysis of crcB sequence variations across isolates with different antibiotic resistance profiles

    • Longitudinal studies tracking crcB sequence and expression during antibiotic treatment courses

    • Correlation between CrcB function and documented defense mechanisms against antibiotics in clinical B. cenocepacia strains

This comprehensive approach would clarify whether CrcB directly contributes to antibiotic resistance mechanisms or indirectly influences resistance through effects on membrane physiology or stress responses.

What are the most promising avenues for translational research on Burkholderia cenocepacia CrcB homolog that could impact clinical management of infections?

The most promising translational research avenues for B. cenocepacia CrcB include:

  • Drug target validation:

    • Confirmation of essentiality in clinically relevant conditions (oxygen limitation, biofilms, host tissues)

    • High-throughput screening for small molecule inhibitors of CrcB function

    • Structure-based drug design leveraging predicted or determined CrcB structures

  • Diagnostic applications:

    • Development of molecular diagnostics targeting crcB sequence variations associated with virulence or treatment response

    • Assessment of CrcB as a biomarker for B. cenocepacia adaptation during chronic infection

    • Integration with other markers for comprehensive profiling of B. cenocepacia clinical isolates

  • Combination therapy approaches:

    • Investigation of synergistic effects between CrcB inhibition and existing antibiotics

    • Development of fluoride-based adjuvant therapies that might overwhelm CrcB capacity

    • Testing of membrane-active agents that might compromise CrcB function indirectly

  • Host response modulation:

    • Exploration of how CrcB affects host immune recognition of B. cenocepacia

    • Assessment of whether CrcB-mediated adaptations contribute to immune evasion

    • Development of strategies to enhance immune clearance by targeting CrcB-dependent processes

  • Microbiome interactions:

    • Investigation of how CrcB contributes to B. cenocepacia's interactions with other microorganisms in polymicrobial infections

    • Assessment of potential horizontal gene transfer of crcB or related resistance determinants

    • Exploration of ecological approaches to managing B. cenocepacia infections by targeting CrcB-dependent competitive advantages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.