Recombinant Burkholderia cenocepacia Protein CrcB homolog (crcB) is a genetically engineered protein derived from the fluoride ion transporter CrcB of the opportunistic pathogen B. cenocepacia. This protein is expressed in Escherichia coli with an N-terminal His-tag for purification and functional studies. CrcB homologs are implicated in bacterial stress responses, particularly resistance to fluoride ions, which are toxic to microbial cells .
The recombinant CrcB protein consists of 128 amino acids (UniProt ID: Q1BYC6) with the sequence:
MFYSIVAIFVGAGLGALLRWFLSLALNAFFPAVPLGTLASNLIGGYVIGVAAVVFTVRVGLPPEWRLFVITGFLGGLTTFSTYSVEVMTHALEGEFGWALAVAALHLTGSFALTALGMWTARAWLAAA .
CrcB belongs to the CrcB superfamily (Pfam: PF04389), characterized by six transmembrane helices. Structural predictions suggest its role in fluoride ion transport or efflux, though experimental validation in B. cenocepacia remains limited .
While direct studies on B. cenocepacia CrcB are sparse, homologs in other bacteria provide mechanistic clues:
Fluoride Resistance: E. coli CrcB mediates fluoride efflux via proton antiport, enabling survival in high-fluoride environments .
Stress Adaptation: CrcB-like proteins in Pseudomonas aeruginosa regulate biofilm formation under oxidative stress, suggesting a potential role in B. cenocepacia virulence .
The recombinant CrcB protein serves as a tool to investigate:
Ion Transport Mechanisms: Fluoride efflux pathways in Burkholderia species.
Pathogen Survival: Contributions to persistence in cystic fibrosis lungs, where fluoride concentrations fluctuate.
Antimicrobial Targets: Potential for disrupting ion homeostasis to combat multidrug-resistant B. cenocepacia infections .
Current knowledge gaps include:
KEGG: bcm:Bcenmc03_0908
CrcB homologs are typically identified through computational genomic analysis using:
Hidden Markov Models (HMMs): Researchers use the CrcB-like protein Camphor Resistance (CrcB) HMM with a gathering threshold of 32.9, as demonstrated in studies of Pseudomonas species .
Sequence similarity searches: Tools like hmmsearch 3.1b2 are employed to determine the significance of potential matches in the genome .
Pairwise BLAST analysis: This method helps determine percent identities between identified putative CrcB sequences and established reference sequences .
For B. cenocepacia specifically, researchers would likely align potential sequences against well-characterized CrcB proteins from related organisms, such as P. putida ATCC 12633, which has been used as a reference for identifying CrcB homologs in other species .
Functional validation of CrcB proteins typically employs these methodologies:
Gene knockout/complementation studies: Creating conditional mutants (as demonstrated with other essential proteins in B. cenocepacia) where gene expression is placed under a controlled promoter (e.g., rhamnose-inducible) .
Phenotypic characterization: Observing cellular morphology and viability under depletion conditions, similar to studies with MurJ in B. cenocepacia .
Fluoride sensitivity assays: Measuring bacterial growth in media containing varying concentrations of fluoride to assess CrcB function in fluoride resistance.
Membrane protein localization: Using fluorescent protein fusions or epitope tags to confirm membrane localization of CrcB.
Complementation with homologs: Testing functional conservation by expressing CrcB homologs from other bacterial species, similar to the reciprocal complementation approach used with MurJ between B. cenocepacia and E. coli .
While the specific structure of B. cenocepacia CrcB has not been fully characterized in the literature provided, comparative structural analysis would typically involve:
Computational structural prediction: Using tools like AlphaFold or homology modeling based on crystallized CrcB structures from other bacteria.
Sequence alignment analysis: Comparing conserved domains and motifs across various bacterial species, identifying B. cenocepacia-specific variations that might relate to function.
Transmembrane topology prediction: CrcB proteins generally contain multiple transmembrane domains that form ion channels.
Functional implications from structural differences could involve:
Altered ion selectivity or conductance
Different regulatory mechanisms
Varied interactions with other membrane components
Adaptations specific to B. cenocepacia's environmental niches
The identification of CrcB homologs in Pseudomonas species showed varying degrees of sequence identity compared to reference strains , suggesting potential functional variations across bacterial species that would be worthy of investigation in B. cenocepacia.
B. cenocepacia is known to undergo significant adaptive evolution during chronic cystic fibrosis (CF) infections, with bacteria accumulating mutations at a rate of approximately 2.08 SNPs/year . While CrcB specifically isn't mentioned in the adaptation studies, several patterns of bacterial evolution in the CF lung environment could implicate CrcB function:
Oxidative stress response: CF lungs present a high-oxidative stress environment, and B. cenocepacia accumulates mutations in genes associated with oxidative stress response . If CrcB contributes to membrane integrity or ion homeostasis, it may play a role in this adaptive response.
Metal ion homeostasis: Genes related to transition metal metabolism are hotspots for nucleotide polymorphism in B. cenocepacia during CF infections . As an ion channel protein, CrcB might intersect with these pathways.
Environmental adaptation: Two orthologous genes shared by B. cenocepacia and B. multivorans were found to be under strong selection during CF infection, including a nucleotide sugar dehydratase involved in lipopolysaccharide O-antigen biosynthesis and a two-component regulatory sensor kinase . This suggests membrane components and sensing systems are critical for adaptation, potentially implicating membrane proteins like CrcB.
Antibiotic resistance: B. cenocepacia evolves mechanisms against antibiotics during chronic infections . CrcB's role in membrane function could potentially influence antibiotic uptake or efflux.
For successful production and purification of recombinant B. cenocepacia CrcB, I recommend this methodological workflow:
Expression system selection:
E. coli C41(DE3) or C43(DE3) strains specialized for membrane protein expression
Alternative systems like Pichia pastoris for eukaryotic-like post-translational modifications if needed
Vector design considerations:
Inclusion of affinity tags (His6, FLAG, or MBP) for purification
Fusion to GFP for expression monitoring and proper folding assessment
Incorporation of a precision protease cleavage site for tag removal
Expression optimization:
Temperature modulation (typically 16-20°C for membrane proteins)
Induction parameter testing (IPTG concentration 0.1-1.0 mM)
Testing various media formulations (TB, LB, minimal media with supplements)
Extraction protocol:
Membrane fraction isolation through differential centrifugation
Gentle solubilization using detergents appropriate for ion channels:
| Detergent | Critical Micelle Concentration (mM) | Advantages | Considerations |
|---|---|---|---|
| DDM | 0.17 | Mild, widely used | Large micelles |
| LMNG | 0.01 | High stability | Expensive |
| Digitonin | 0.5 | Native-like environment | Natural source variability |
| SMA copolymer | N/A | Preserves lipid environment | pH limitations |
Purification strategy:
IMAC (immobilized metal affinity chromatography) as initial capture step
Size exclusion chromatography for final polishing and buffer exchange
Optional ion exchange chromatography if higher purity is required
Functional validation:
Liposome reconstitution and ion flux assays
Fluoride binding assays
Thermostability assessment using differential scanning fluorimetry
This approach builds on methodology similar to that used in other bacterial membrane protein studies, adapted for the specific challenges of CrcB as an ion channel protein.
To investigate protein-protein interactions involving the CrcB homolog in B. cenocepacia, researchers should consider these methodological approaches:
In vivo protein-protein interaction methods:
Bacterial two-hybrid system: Optimized for membrane proteins using split ubiquitin or adenylate cyclase-based systems
Förster Resonance Energy Transfer (FRET): Using fluorescent protein fusions to detect proximity between CrcB and potential partners
Bimolecular Fluorescence Complementation (BiFC): Particularly useful for validating interactions in the native cellular environment
Co-immunoprecipitation approaches:
Epitope tagging of CrcB (ensuring tag placement doesn't interfere with function)
Crosslinking prior to solubilization to capture transient interactions
Mass spectrometry analysis of co-precipitated proteins
Proximity labeling techniques:
BioID or TurboID fusion to CrcB for biotinylation of proximal proteins
APEX2 fusion for peroxidase-based proximity labeling
Analysis of labeled proteins via streptavidin pulldown and mass spectrometry
Genetic interaction screening:
Synthetic genetic array analysis with conditional CrcB mutants
Transposon insertion sequencing (Tn-Seq) in CrcB-depleted backgrounds
Suppressor screens to identify genes that mitigate CrcB depletion phenotypes
Functional correlation analysis:
Comparative phenotyping of CrcB mutants with other membrane protein mutants
Lipidomic analysis to identify lipid compositional changes that might affect multiple membrane proteins including CrcB
When interpreting results, researchers should account for artificial interactions that may arise due to membrane protein overexpression or tag interference, validating key findings through multiple independent methods.
To investigate CrcB's role in fluoride resistance in B. cenocepacia clinical isolates, I recommend this comprehensive experimental framework:
Genetic characterization:
Sequence analysis of crcB across clinical isolates to identify natural variants
Correlation of sequence variations with patient data, infection chronicity, and treatment history
Creation of conditional crcB mutants using rhamnose-inducible promoters as demonstrated with other essential genes in B. cenocepacia
Phenotypic assessment:
Minimal inhibitory concentration (MIC) determination for fluoride in various clinical isolates
Growth curve analysis under fluoride stress conditions
Viability assessment using live/dead staining during fluoride exposure
Complementation studies with wild-type crcB to confirm phenotype specificity
Fluoride transport measurement:
Use of fluoride-sensitive electrodes to measure intracellular vs. extracellular fluoride concentrations
Fluoride ion flux assays in membrane vesicles prepared from wild-type and crcB-depleted cells
Radiolabeled or fluorescent fluoride analog uptake/efflux studies
Physiological impact assessment:
Transcriptomic analysis comparing wild-type and crcB-depleted cells with and without fluoride stress
Metabolomic profiling to identify affected pathways
Membrane integrity assessment using fluorescent dyes and microscopy
Clinical relevance investigation:
Comparison of fluoride resistance between isolates from early infection vs. chronic infection stages
Analysis of crcB expression levels in different infection environments
Correlation between fluoride resistance and antibiotic susceptibility profiles
This approach combines genetic, biochemical, and physiological methods to comprehensively characterize CrcB's role in fluoride resistance and its potential significance in clinical contexts.
Designing effective conditional knockout systems for studying potentially essential genes like crcB in B. cenocepacia requires careful methodological planning:
Promoter selection:
The rhamnose-inducible promoter (Prha) has been successfully used in B. cenocepacia for conditional gene expression, as demonstrated with murJ
Ensure tight regulation with minimal leakiness under non-inducing conditions
Confirm that the promoter remains functional in the infection models or conditions being studied
Integration strategy:
Homologous recombination to replace the native promoter with the inducible system
Retention of the native ribosome binding site to maintain translation efficiency
Inclusion of verification markers (e.g., antibiotic resistance) for selection
Verification methods:
PCR confirmation of correct integration
Sequencing across junction regions
RT-qPCR to confirm conditional expression
Western blotting (if antibodies available) to verify protein levels
Control considerations:
Construction of parallel strains with non-essential genes under the same promoter
Wild-type controls grown under identical conditions with and without inducer
Complementation controls with the wild-type gene on a plasmid
Phenotypic analysis parameters:
Establish clear timepoints for analysis after inducer withdrawal
Monitor growth rate, cell morphology, and viability at multiple timepoints
Include controls for potential metabolic effects of the inducer itself
Potential challenges:
B. cenocepacia possesses multiple chromosomes and may have compensatory genes
The unique cell wall structure of B. cenocepacia might affect phenotype manifestation
Clinical isolates may exhibit variable responses compared to reference strains
When implementing this approach, researchers should be aware that B. cenocepacia stopped growing and displayed morphological abnormalities under depletion conditions of another essential gene (murJ), eventually undergoing cell lysis , which provides a precedent for the expected phenotype if crcB is similarly essential.
Differentiating direct from indirect effects in CrcB depletion studies requires a multi-faceted experimental approach:
Temporal analysis of phenotypic changes:
Establish a detailed time course of events following CrcB depletion
Primary (direct) effects typically manifest earlier than secondary consequences
Quantitative measurements at multiple time points can reveal the sequence of cellular changes
Complementation strategies:
Rapid restoration of CrcB expression to determine which phenotypes are immediately rescued
Use of CrcB homologs from other species with varying functional properties
Domain-specific mutations to correlate specific CrcB functions with observed phenotypes
Biochemical validation approaches:
Direct measurement of the presumed primary function (fluoride transport)
Assessment of membrane potential and other ion gradients
Lipidomic and metabolomic profiling to identify immediate biochemical changes
Suppressor mutant analysis:
Identification of spontaneous or engineered mutations that mitigate CrcB depletion phenotypes
Characterization of suppressor pathways can reveal direct vs. compensatory mechanisms
Rational targeting of related pathways to test specific hypotheses
Systems biology approaches:
Time-resolved transcriptomics and proteomics following CrcB depletion
Network analysis to distinguish primary response pathways from downstream effects
Correlation of expression patterns with known stress responses
Methodological controls:
Comparison with depletion of other membrane proteins (specificity control)
Partial depletion studies to identify dose-dependent effects
Parallel analysis under various environmental conditions to distinguish context-dependent effects
This systematic approach helps researchers build a model of causality rather than simply cataloging phenotypic changes associated with CrcB depletion.
For identifying potential functional partners of CrcB in B. cenocepacia, I recommend this comprehensive bioinformatic workflow:
Co-evolution analysis:
Genomic context analysis:
Examination of gene neighborhood conservation across related species
Identification of conserved operons or gene clusters containing crcB
Analysis of shared transcriptional regulation using motif discovery tools
Protein-protein interaction prediction:
Structural modeling of CrcB using AlphaFold or similar tools
Protein-protein docking simulations with candidate partners
Interface residue conservation analysis across homologs
Functional association networks:
Text mining of scientific literature for co-mentioned proteins
Integration of data from STRING and similar databases
Analysis of co-expression patterns across different conditions
Comparative analysis with model organisms:
| Analysis Type | Key Tools | Expected Outcomes | Validation Approach |
|---|---|---|---|
| Sequence-based | HMMER, BLASTp, InterProScan | Homology relationships | Sequence conservation metrics |
| Structure-based | AlphaFold, HADDOCK, PyMOL | 3D interaction models | Energy minimization scores |
| Network-based | STRING, Cytoscape, WGCNA | Functional association networks | Cluster analysis statistics |
| Genomic context | MicrobesOnline, IMG/M | Conserved operons | Phylogenetic distribution |
This integrated approach leverages diverse computational methods to generate testable hypotheses about CrcB's functional partners, which can then be validated experimentally.
Studying CrcB could significantly advance our understanding of B. cenocepacia adaptation through these research directions:
Environmental stress adaptation:
CrcB's role in fluoride resistance may extend to other halide ions or stress conditions relevant to CF lungs
Investigation of how CrcB expression and function changes during the transition from environmental to host niches
Examination of CrcB's potential contribution to the documented oxidative stress responses in CF infections
Evolution during chronic infection:
Sequence analysis of crcB across longitudinal clinical isolates to identify selective pressures
Comparison with the documented evolution rates of 2.08 SNPs/year observed in B. cenocepacia during CF infections
Assessment of whether crcB mutations correlate with other adaptive changes in membrane components
Biofilm formation and persistence:
Potential role of CrcB in maintaining ion homeostasis within biofilm structures
Investigation of CrcB's contribution to the transition between planktonic and biofilm lifestyles
Correlation between CrcB function and antibiotic tolerance in biofilms
Host-pathogen interactions:
CrcB's potential role in responding to host defense mechanisms, particularly those involving antimicrobial peptides or oxidative stress
Investigation of whether CrcB affects cell surface properties that modulate host immune recognition
Potential connection to the documented adaptation to low oxygen and iron concentrations in CF infections
Therapeutic implications:
Assessment of CrcB as a potential drug target, particularly if it proves essential under infection-relevant conditions
Investigation of potential synergies between CrcB inhibition and existing antibiotics
Development of fluoride-based combination therapeutics that might leverage CrcB function
This research would connect the molecular function of CrcB to the broader ecological and clinical contexts of B. cenocepacia infections, potentially revealing new therapeutic approaches for this challenging pathogen.
The potential role of CrcB in antibiotic resistance mechanisms of B. cenocepacia could be investigated through these experimental approaches:
Antibiotic susceptibility profiling:
Determination of minimum inhibitory concentrations (MICs) for various antibiotic classes in wild-type vs. CrcB-depleted strains
Time-kill kinetics to assess rate of bacterial death under antibiotic pressure
Biofilm antibiotic tolerance assessment to evaluate CrcB's role in structured communities
Membrane permeability studies:
Fluorescent dye uptake assays (e.g., SYTOX Green, propidium iodide) to assess membrane integrity
Measurement of antibiotic accumulation using radiolabeled or fluorescent antibiotics
Assessment of membrane potential using voltage-sensitive dyes
Genetic interaction studies:
Construction of double mutants combining CrcB depletion with known resistance determinants
Transposon mutagenesis screens in CrcB-depleted backgrounds to identify synthetic lethal interactions
Overexpression of CrcB to determine if it enhances resistance to specific antibiotics
Molecular mechanism investigation:
Transcriptomic and proteomic profiling to identify changes in expression of known resistance genes upon CrcB depletion
Assessment of cell wall composition changes, given that B. cenocepacia with depleted essential proteins (e.g., MurJ) showed increased sensitivity to β-lactam antibiotics
Investigation of potential effects on efflux pump activity through functional assays
Clinical correlation studies:
Analysis of crcB sequence variations across isolates with different antibiotic resistance profiles
Longitudinal studies tracking crcB sequence and expression during antibiotic treatment courses
Correlation between CrcB function and documented defense mechanisms against antibiotics in clinical B. cenocepacia strains
This comprehensive approach would clarify whether CrcB directly contributes to antibiotic resistance mechanisms or indirectly influences resistance through effects on membrane physiology or stress responses.
The most promising translational research avenues for B. cenocepacia CrcB include:
Drug target validation:
Confirmation of essentiality in clinically relevant conditions (oxygen limitation, biofilms, host tissues)
High-throughput screening for small molecule inhibitors of CrcB function
Structure-based drug design leveraging predicted or determined CrcB structures
Diagnostic applications:
Development of molecular diagnostics targeting crcB sequence variations associated with virulence or treatment response
Assessment of CrcB as a biomarker for B. cenocepacia adaptation during chronic infection
Integration with other markers for comprehensive profiling of B. cenocepacia clinical isolates
Combination therapy approaches:
Investigation of synergistic effects between CrcB inhibition and existing antibiotics
Development of fluoride-based adjuvant therapies that might overwhelm CrcB capacity
Testing of membrane-active agents that might compromise CrcB function indirectly
Host response modulation:
Exploration of how CrcB affects host immune recognition of B. cenocepacia
Assessment of whether CrcB-mediated adaptations contribute to immune evasion
Development of strategies to enhance immune clearance by targeting CrcB-dependent processes
Microbiome interactions:
Investigation of how CrcB contributes to B. cenocepacia's interactions with other microorganisms in polymicrobial infections
Assessment of potential horizontal gene transfer of crcB or related resistance determinants
Exploration of ecological approaches to managing B. cenocepacia infections by targeting CrcB-dependent competitive advantages