Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcen_0802 (Bcen_0802)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia cenocepacia UPF0060 Membrane Protein Bcen_0802

The Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcen_0802 (Bcen_0802) is a full-length, His-tagged protein engineered for research applications. Expressed in E. coli, it corresponds to the gene bcen_0802 (UniProt ID: Q1BXE3), encoding a 110-amino acid membrane protein. This recombinant construct is critical for studying bacterial membrane biology, particularly in Burkholderia cenocepacia, a pathogen linked to cystic fibrosis and opportunistic infections .

Potential Role in Bacterial Pathogenicity

While direct functional data for Bcen_0802 is limited, Burkholderia cenocepacia is known for:

  • Pigment Production: Synthesis of melanin-like pigments (e.g., homogentisate-derived) to counter oxidative stress .

  • Membrane Adaptation: Hydrophobic mismatch responses (e.g., helix tilt, lipid segregation) to stabilize membrane proteins .

  • Host Evasion: Modulation of phagosome-lysosome fusion via Rab7 cycling to persist in macrophages .

Bcen_0802 may participate in membrane integrity, stress response, or virulence factor transport, though further studies are needed.

Comparative Analysis

FeatureBcen_0802Other Bcc Proteins
OrthologsLimited dataVariable conservation
Membrane InsertionLikely Sec61-dependent Tail-anchored proteins use TRC40/Get3
Stress ResponseHypotheticalOxidative stress genes (e.g., hppD)

Future Research Directions

  1. Functional Annotation: CRISPR knockout studies to link Bcen_0802 to virulence or membrane biogenesis.

  2. Structural Biology: Nanodisc-based NMR/X-ray crystallography to resolve transmembrane architecture .

  3. Evolutionary Analysis: Compare orthologs in B. multivorans and B. cenocepacia to identify adaptive mutations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Bcen_0802; UPF0060 membrane protein Bcen_0802
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain AU 1054)
Target Names
Bcen_0802
Target Protein Sequence
MTELMRIAALFAATALAEIVGCYLPWLVLKAGRPAWLLVPAALSLALFAWLLTLHPSAAG RTYAAYGGVYIAVALIWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia cenocepacia UPF0060 membrane protein Bcen_0802?

Burkholderia cenocepacia UPF0060 membrane protein Bcen_0802 (UniProt ID: Q1BXE3) is a 110-amino acid transmembrane protein belonging to the UPF0060 family. This protein is encoded by the Bcen_0802 gene in Burkholderia cenocepacia, a gram-negative bacterium known for its role as an opportunistic pathogen in cystic fibrosis patients. The recombinant version of this protein is typically produced with a His-tag for purification purposes and expressed in heterologous systems such as E. coli. The protein's function remains partially characterized, but structural analyses suggest it plays a role in membrane integrity or transport mechanisms within the bacterial cell envelope .

What expression systems are recommended for Bcen_0802 production?

The optimal expression system for Bcen_0802 production is E. coli, which has demonstrated reliable yields and proper folding of the target protein. When designing your expression experiment, consider the following methodological approach:

  • Vector selection: pET-based vectors with N-terminal His-tags have proven effective for maintaining protein solubility

  • E. coli strain optimization: BL21(DE3) or Rosetta strains are preferred for membrane protein expression

  • Induction conditions: IPTG concentration between 0.1-0.5 mM at mid-log phase (OD600 = 0.6-0.8)

  • Growth temperature: Reduce to 18-20°C post-induction to enhance proper folding

  • Media supplementation: Addition of 5% glycerol can improve protein stability

The experimental design should include appropriate controls, including empty vector expressions and variations in induction parameters to optimize yield .

What are the recommended storage and reconstitution protocols for Bcen_0802?

For optimal experimental results, adhere to the following evidence-based storage and reconstitution protocol:

Storage protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, aliquot to avoid repeated freeze-thaw cycles

  • For working stocks, store at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 50% and store at -80°C

Reconstitution methodology:

  • Briefly centrifuge the vial before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for stability

  • Aliquot into single-use volumes to prevent degradation from freeze-thaw cycles

These protocols have been established to maintain protein integrity and functionality. When designing experiments, include stability tests at different time points to verify protein quality before proceeding with functional assays .

What experimental designs are optimal for studying Bcen_0802 function?

When investigating Bcen_0802 function, a multi-faceted experimental design approach yields the most comprehensive results. Consider implementing the following methodological framework:

  • Loss-of-function studies:

    • Generate knockout mutants using CRISPR-Cas9 or homologous recombination

    • Compare growth rates, membrane integrity, and stress responses between wildtype and mutant strains

    • Measure phenotypic changes under varying environmental conditions (pH, temperature, osmotic stress)

  • Protein-protein interaction analysis:

    • Employ bacterial two-hybrid systems to identify interaction partners

    • Use co-immunoprecipitation with His-tagged Bcen_0802 as bait

    • Validate interactions with microscopy-based techniques such as FRET or BiFC

  • Localization studies:

    • Create GFP fusion constructs to track subcellular localization

    • Use immunogold electron microscopy for high-resolution localization

    • Perform membrane fractionation to confirm membrane association

  • Structure-function analyses:

    • Generate point mutations in conserved residues

    • Conduct complementation assays with mutated constructs

    • Correlate structural features with functional outcomes

When designing these experiments, adhere to rigorous controls, including empty vector controls, wild-type strain comparisons, and technical replicates to ensure statistical validity. Additionally, implement a between-subjects experimental design when comparing different bacterial strains and a within-subjects design when measuring responses to environmental variations .

How can researchers investigate Bcen_0802's role in membrane integrity?

Investigating Bcen_0802's role in membrane integrity requires a systematic approach combining biophysical techniques and molecular biology. The following experimental design methodology is recommended:

  • Membrane permeability assays:

    • Compare wild-type and Bcen_0802-knockout strains using fluorescent dyes (propidium iodide, SYTO9)

    • Measure the uptake kinetics of membrane-impermeable antibiotics

    • Utilize patch-clamp techniques to detect changes in membrane conductance

  • Lipid interaction studies:

    • Reconstitute purified Bcen_0802 in liposomes of varying lipid compositions

    • Measure protein-lipid interactions using surface plasmon resonance

    • Analyze lipid rafts distribution in presence/absence of Bcen_0802

  • Stress response experiments:

    • Subject bacterial cultures to membrane stressors (detergents, osmotic shock)

    • Monitor gene expression changes using RT-qPCR targeting membrane integrity markers

    • Assess survival rates under progressive membrane-damaging conditions

The experimental design should include appropriate controls and multiple biological replicates. Additionally, researchers should implement a randomized complete block design to account for batch effects in bacterial cultures. Analyze data using mixed-effects models to account for variation between experimental batches .

What techniques can be used to study Bcen_0802 protein-protein interactions?

To comprehensively investigate Bcen_0802 protein-protein interactions, researchers should implement a multi-technique approach that confirms interactions through complementary methods:

  • In vivo interaction techniques:

    • Bacterial two-hybrid system: Construct fusion proteins with split adenylate cyclase domains

    • Split-GFP complementation: Engineer Bcen_0802 and putative partners with split GFP fragments

    • FRET/BRET assays: Generate fluorescent protein fusions to measure energy transfer

  • In vitro validation methods:

    • Pull-down assays: Use His-tagged Bcen_0802 with bacterial lysates followed by mass spectrometry

    • Surface plasmon resonance: Measure binding kinetics of purified interaction candidates

    • Isothermal titration calorimetry: Determine thermodynamic parameters of specific interactions

  • Structural interaction analysis:

    • Cross-linking coupled with mass spectrometry: Identify proximity-based interactions

    • Hydrogen-deuterium exchange: Map interaction interfaces

    • Cryo-EM analysis: Visualize complexes at near-atomic resolution

For experimental design, implement a factorial approach testing multiple potential interacting partners under varying conditions (pH, salt concentration, temperature). This allows for the identification of condition-dependent interactions that may be physiologically relevant. Control experiments should include non-relevant proteins to establish specificity thresholds and statistical significance of observed interactions .

How can researchers address data inconsistencies in Bcen_0802 functional studies?

When encountering data inconsistencies in Bcen_0802 functional studies, implement the following systematic troubleshooting methodology:

  • Standardize experimental conditions:

    • Develop a detailed protocol documenting all buffer compositions, incubation times, and temperatures

    • Use consistent protein batches with verified purity (>90% by SDS-PAGE)

    • Implement internal controls in each experiment to normalize between runs

  • Address technical variability:

    • Conduct power analysis to determine appropriate sample sizes

    • Implement blinded analysis workflows where possible

    • Use multiple analytical techniques to verify the same outcome

  • Identify confounding variables:

    Potential ConfounderMitigation Strategy
    Protein aggregationAdd stabilizing agents; monitor by dynamic light scattering
    E. coli host proteinsImplement more stringent purification; verify by mass spectrometry
    Buffer componentsSystematic testing of buffer effects on protein activity
    Environmental variablesControl temperature, pH, and oxygen levels rigorously
  • Reconciliation of contradictory data:

    • Perform meta-analysis of existing datasets

    • Design bridging experiments specifically targeting discrepancies

    • Consider hypothesis refinement if data consistently challenges current models

When data inconsistencies persist, consider implementing a Bayesian experimental design approach, which allows for the integration of prior knowledge and iterative refinement of experiments based on accumulated data. This method is particularly useful for complex biological systems where multiple variables influence outcomes .

What methods are effective for studying Bcen_0802 interactions with antimicrobial compounds?

To investigate Bcen_0802 interactions with antimicrobial compounds, implement the following experimental design strategy:

  • Binding assay methodology:

    • Microscale thermophoresis: Measure direct binding of fluorescently labeled antimicrobials to purified Bcen_0802

    • Isothermal titration calorimetry: Determine thermodynamic parameters of binding

    • Fluorescence quenching assays: Monitor intrinsic tryptophan fluorescence changes upon compound binding

  • Functional consequence assessment:

    • Minimum inhibitory concentration (MIC) comparison: Between wild-type and Bcen_0802-depleted strains

    • Time-kill kinetics: Measure bacterial killing rates in presence/absence of functional Bcen_0802

    • Membrane permeability changes: Use fluorescent probes to detect altered membrane integrity

  • Resistance development monitoring:

    • Serial passage experiments: Compare resistance acquisition rates between strains

    • Whole genome sequencing: Identify compensatory mutations in Bcen_0802-altered strains

    • Transcriptome analysis: Detect expression changes in related membrane proteins

The experimental design should follow a between-subjects approach, comparing wild-type, knockout, and complemented strains in parallel. Include appropriate positive controls (known membrane-targeting antibiotics) and negative controls (compounds with unrelated mechanisms). Additionally, implement concentration gradients to establish dose-response relationships rather than single-dose experiments .

How should researchers design experiments to study Bcen_0802 expression under different environmental conditions?

When designing experiments to investigate Bcen_0802 expression under varying environmental conditions, implement a systematic factorial design approach:

  • Experimental design framework:

    • Use a full factorial design with at least three biological replicates

    • Include time-course measurements to capture expression dynamics

    • Implement appropriate negative and positive controls for each condition

  • Key variables to manipulate:

    Environmental FactorExperimental RangeMeasurement Intervals
    Temperature25°C, 30°C, 37°C, 42°CEvery 2 hours for 12 hours
    pH5.5, 6.5, 7.4, 8.0At 0, 4, 8, and 12 hours
    Oxygen levelsAerobic, Microaerobic, AnaerobicAt 0, 6, and 12 hours
    Nutrient limitationCarbon, Nitrogen, Phosphorus restrictionAt mid-log and stationary phases
    Antimicrobial stressSub-MIC levels of relevant antibioticsPre-exposure, 30 min, 2 hours post-exposure
  • Expression measurement methodology:

    • RT-qPCR for transcript-level analysis (normalize to validated reference genes)

    • Western blotting with anti-His antibodies for protein-level detection

    • Reporter gene fusions (e.g., Bcen_0802 promoter driving GFP) for real-time monitoring

  • Data analysis approach:

    • Use mixed-effects models to account for random effects between biological replicates

    • Employ principal component analysis to identify patterns across multiple conditions

    • Perform cluster analysis to group conditions with similar expression profiles

This experimental design allows for the systematic identification of environmental factors influencing Bcen_0802 expression while controlling for confounding variables. The factorial approach enables detection of interaction effects between environmental factors that may be biologically significant .

What are the best practices for developing antibodies against Bcen_0802 for research applications?

Developing specific antibodies against Bcen_0802 requires a methodical approach to ensure specificity and functionality in research applications:

  • Antigen design strategy:

    • Full-length protein approach: Express and purify His-tagged Bcen_0802 for immunization

    • Peptide-based approach: Select 2-3 peptides from hydrophilic, surface-exposed regions

    • Recommended peptide regions: N-terminal (residues 2-16) and C-terminal (residues 95-110)

  • Immunization protocol optimization:

    • Select 2-3 animal species (typically rabbit, mouse, and goat) for diverse antibody properties

    • Implement a prime-boost schedule with at least 3-4 immunizations

    • Use appropriate adjuvants (complete Freund's for primary, incomplete for boosters)

  • Antibody screening and validation methodology:

    Validation TestPurposeAcceptance Criteria
    ELISA against immunogenConfirm antibody productionTiter >1:10,000
    Western blot vs. recombinant proteinVerify specificitySingle band at ~12 kDa
    Western blot vs. bacterial lysatesConfirm native protein detectionSpecific band in wildtype, absent in knockout
    ImmunoprecipitationValidate functionality>70% target protein recovery
    ImmunofluorescenceConfirm localization detectionMembrane staining pattern
    Cross-reactivity testingAssess specificityNo signal with homologous proteins
  • Affinity purification approach:

    • Immobilize recombinant Bcen_0802 on affinity column

    • Purify antibodies through positive selection followed by negative selection

    • Validate purified antibodies via specificity testing

When designing experiments using these antibodies, include appropriate controls, including pre-immune sera, isotype controls, and validation in Bcen_0802 knockout strains. This ensures that observed signals are truly specific to the target protein rather than artifacts or cross-reactions .

How can researchers accurately quantify Bcen_0802 in complex biological samples?

Accurate quantification of Bcen_0802 in complex biological samples requires a multi-technique approach with appropriate calibration and controls:

  • Sample preparation methodology:

    • Optimize lysis conditions specifically for membrane proteins (detergent selection critical)

    • Implement differential centrifugation to isolate membrane fractions

    • Consider crosslinking prior to lysis to preserve protein complexes

  • Quantification techniques comparison:

    TechniqueSensitivityAdvantagesLimitations
    Western blot~1-10 ngSpecific detection, widely availableSemi-quantitative, narrow dynamic range
    ELISA~10-100 pgHigh throughput, good sensitivityRequires validated antibodies, potential matrix effects
    Selected Reaction Monitoring (SRM)~10-100 pgAbsolute quantification, no antibody neededRequires specialized equipment, complex method development
    Parallel Reaction Monitoring (PRM)~1-10 pgHighest specificity and sensitivityRequires high-end mass spectrometer
  • Calibration strategy:

    • Generate standard curves using purified recombinant Bcen_0802

    • Include internal standard controls (isotope-labeled peptides for MS methods)

    • Prepare matrix-matched standards to account for sample composition effects

  • Validation parameters assessment:

    • Determine limit of detection (LOD) and limit of quantification (LOQ)

    • Evaluate precision (intra-day and inter-day coefficients of variation <15%)

    • Assess accuracy through spike-recovery experiments (acceptable range: 80-120%)

When designing experiments, implement a randomized block design to minimize batch effects and include quality control samples throughout the analysis sequence. For mass spectrometry-based approaches, select at least two peptides unique to Bcen_0802 and monitor multiple transitions per peptide to ensure specificity .

What statistical approaches are recommended for analyzing Bcen_0802 functional data?

  • Preliminary data assessment:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Assess homogeneity of variance with Levene's test

    • Identify and address outliers using robust statistical methods

  • Appropriate statistical tests selection:

    Experimental DesignRecommended TestWhen to Use
    Two groups, parametricStudent's t-test or Welch's t-testComparing wildtype vs. knockout, normal distribution
    Multiple groups, one factorOne-way ANOVA with post-hoc testsComparing multiple mutations or conditions
    Multiple groups, multiple factorsFactorial ANOVATesting interaction between variables (e.g., mutation × stress)
    Non-parametric dataMann-Whitney U or Kruskal-WallisWhen normality assumptions are violated
    Repeated measurementsMixed-effects modelsTime-course experiments, nested designs
  • Advanced analysis approaches:

    • Multivariate analysis: Principal Component Analysis or Discriminant Analysis for complex datasets

    • Regression models: For dose-response relationships or continuous predictors

    • Bayesian analysis: When incorporating prior knowledge or with limited sample sizes

  • Effect size reporting:

    • Report Cohen's d or similar metrics to quantify magnitude of effects

    • Calculate and report confidence intervals around estimates

    • Provide exact p-values rather than threshold-based significance

When designing experiments, conduct power analysis a priori to determine appropriate sample sizes, targeting 80-90% power to detect biologically meaningful effects. For complex designs, consult with a statistician during the planning phase rather than after data collection. All analyses should be pre-registered to avoid p-hacking and increase reproducibility .

How should researchers interpret contradictory findings in Bcen_0802 studies?

When faced with contradictory findings in Bcen_0802 studies, implement this structured interpretation framework:

  • Systematic comparison methodology:

    • Create a comprehensive comparison table of contradictory studies

    • Evaluate key methodological differences (expression systems, tags, buffer conditions)

    • Assess statistical power and experimental design rigor of each study

    Comparison FactorStudy AStudy BPotential Impact
    Expression systemE. coli BL21Pseudomonas aeruginosaDifferent post-translational modifications
    Protein tag positionN-terminalC-terminalPotential functional interference
    Purification methodNative conditionsDenaturing/refoldingStructural differences
    Buffer compositionHigh salt (500mM NaCl)Low salt (150mM NaCl)Altered protein-protein interactions
    Experimental temperature25°C37°CDifferent membrane fluidity
  • Resolution strategies:

    • Design bridging experiments specifically addressing methodological differences

    • Implement independent validation by third laboratories

    • Develop standardized protocols addressing key variables

  • Integration approaches:

    • Use meta-analysis techniques to quantitatively combine results

    • Apply Bayesian frameworks that incorporate uncertainty

    • Consider contextual factors that might explain apparently contradictory results

  • Bias evaluation:

    • Assess publication bias using funnel plots or related methods

    • Evaluate researcher degrees of freedom in analysis pipelines

    • Consider funding sources and potential conflicts of interest

When encountering contradictions, resist the temptation to selectively cite supportive evidence. Instead, transparently present the full spectrum of findings and focus on identifying the specific conditions under which different results are observed. This approach often leads to deeper insights into context-dependent mechanisms rather than simply rejecting certain findings as "incorrect" .

What emerging technologies show promise for advancing Bcen_0802 research?

Several cutting-edge technologies offer significant potential for advancing Bcen_0802 research through novel methodological approaches:

  • Structural biology advancements:

    • Cryo-electron microscopy: Achieve near-atomic resolution of Bcen_0802 in native membrane environments

    • Micro-electron diffraction (MicroED): Determine structure from microcrystals previously unsuitable for traditional crystallography

    • Integrative structural biology: Combine multiple techniques (NMR, SAXS, computational modeling) for complete structural characterization

  • Functional genomics approaches:

    • CRISPRi/CRISPRa systems: Precisely modulate Bcen_0802 expression without genetic deletion

    • Perturb-seq: Combine CRISPR perturbations with single-cell RNA sequencing for comprehensive phenotyping

    • CRISPR scanning mutagenesis: Systematically assess the functional importance of each residue

  • Advanced imaging techniques:

    • Super-resolution microscopy: Track Bcen_0802 localization and dynamics at nanometer scale

    • Correlative light and electron microscopy: Link protein function to ultrastructural context

    • Expansion microscopy: Physically enlarge samples for improved resolution of membrane organization

  • Systems biology integration:

    • Multi-omics data integration: Combine transcriptomics, proteomics, and metabolomics for holistic understanding

    • Machine learning approaches: Identify patterns in complex datasets to generate novel hypotheses

    • Network analysis: Position Bcen_0802 within broader cellular interaction networks

When implementing these technologies, design experiments with appropriate controls and validation strategies. For example, CRISPR-based approaches should include off-target analysis, and structural studies should validate models with orthogonal techniques. The most significant advances will likely come from integrating multiple approaches rather than relying on any single technology .

What are the key unanswered questions about Bcen_0802 function that require further investigation?

Despite current knowledge about Bcen_0802, several critical questions remain unanswered and warrant systematic investigation:

  • Fundamental biological role:

    • What is the primary physiological function of Bcen_0802 in Burkholderia cenocepacia?

    • How does Bcen_0802 contribute to bacterial survival under stress conditions?

    • Is Bcen_0802 function conserved across bacterial species expressing homologous proteins?

  • Structural-functional relationships:

    • Which amino acid residues are essential for Bcen_0802 function?

    • How does the transmembrane topology influence protein activity?

    • What conformational changes occur during protein function?

  • Interaction networks:

    • What proteins directly interact with Bcen_0802 in the bacterial membrane?

    • Does Bcen_0802 function as a monomer or within a larger complex?

    • How is Bcen_0802 expression and function regulated at the transcriptional and post-translational levels?

  • Pathogenesis relevance:

    • Does Bcen_0802 contribute to virulence or antibiotic resistance in Burkholderia cenocepacia?

    • Could Bcen_0802 serve as a potential drug target for treating resistant infections?

    • How does Bcen_0802 function differ between pathogenic and non-pathogenic strains?

To address these questions, a comprehensive research agenda should implement a multi-faceted approach combining genetic, biochemical, and structural biology techniques. Prioritize experimental designs that allow for direct testing of specific hypotheses rather than descriptive studies. Additionally, consider comparative studies across multiple bacterial species to distinguish conserved functions from species-specific roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.