Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcen2424_1283 (Bcen2424_1283)

Shipped with Ice Packs
In Stock

Description

Introduction

Burkholderia cenocepacia is a Gram-negative bacterium known for causing opportunistic infections, particularly in individuals with cystic fibrosis and other immunocompromising conditions . B. cenocepacia infections are difficult to treat because of the bacterium's resistance, ability to form biofilms, and persistence . The B. cenocepacia genome is large and complex, with many hypothetical genes whose functions remain unknown . Among these are genes coding for small proteins, which have been shown to play roles in biofilm formation, persistence, and intracellular growth .

This article focuses on the Burkholderia cenocepacia UPF0060 membrane protein Bcen2424_1283 (Bcen2424_1283).

General Information

Bcen2424_1283 is a membrane protein found in Burkholderia cenocepacia. Membrane proteins from B. multivorans strain LMG13010 and C1962, or B. cenocepacia strain BC-7 and C1394 can be prepared through a series of centrifugations and resuspensions using specific buffers and protease inhibitors . The final pellets are analyzed for protein content using Bradford assay .

Function and Characteristics

As a UPF0060 family protein, Bcen2424_1283 belongs to a group of proteins with a conserved domain of unknown function (DUF) . Many hypothetical proteins in B. cenocepacia are small, and some are highly expressed in biofilms . Overexpression of some small protein-encoding genes can affect the number of persister cells in biofilms .

Role in Biofilm Formation and Persistence

Small proteins, including membrane proteins, contribute to biofilm formation and bacterial persistence, which are key factors in the pathogenicity of B. cenocepacia . Research has shown that several genes implicated in flagellar assembly were induced during B. cenocepacia adhesion .

Immunoproteomic Analysis

Immunoproteomic analyses have been conducted on membrane protein preparations from different B. cenocepacia strains to identify conserved proteins across species .

6.1. Membrane Protein Preparation

Membrane proteins are typically prepared by centrifugation of cells, followed by resuspension in appropriate buffers containing detergents and protease inhibitors . Ultracentrifugation is used to collect the membrane protein fraction, which is then washed and resuspended for analysis .

6.2. Identification of Immunogenic Membrane Proteins

Proteins can be separated using 2-D gel electrophoresis, and then analyzed by mass spectrometry .

6.3. Construction of eGFP Translational Fusion Reporters

To study the expression of small proteins, translational GFP reporter fusion plasmids can be constructed . The 5′UTR plus approximately 150 nucleotides upstream of the transcription start site (TSS) and up to 50 nucleotides of the coding region are amplified by PCR . The PCR products are then digested and ligated into a plasmid containing an eGFP sequence lacking the start codon . The resulting plasmid is transformed into B. cenocepacia for further analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Bcen2424_1283; UPF0060 membrane protein Bcen2424_1283
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain HI2424)
Target Names
Bcen2424_1283
Target Protein Sequence
MTELMRIAALFAATALAEIVGCYLPWLVLKAGRPAWLLVPAALSLALFAWLLTLHPSAAG RTYAAYGGVYIAVALIWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How might Bcen2424_1283 contribute to B. cenocepacia pathogenesis in cystic fibrosis patients?

    While the specific role of Bcen2424_1283 in pathogenesis remains to be characterized, several hypotheses can be explored based on known functions of membrane proteins in B. cenocepacia:

    1. Biofilm formation: Similar to other membrane proteins in B. cenocepacia, Bcen2424_1283 may contribute to biofilm formation, a critical virulence factor in persistent CF lung infections. The deletion of the OmpA-like BCAL2645 protein significantly impaired biofilm formation and altered colony morphology in B. cenocepacia K56-2 .

    2. Host cell adhesion and invasion: Membrane proteins often mediate bacterial attachment to host cells. BCAL2645 protein was shown to play a role in adherence to mucins and invasion of human lung epithelial cells .

    3. Antibiotic resistance: Membrane proteins can contribute to intrinsic antibiotic resistance, particularly relevant in CF infections where antibiotic therapy is common.

    4. Environmental adaptation: B. cenocepacia adapts to the CF lung environment, and membrane proteins may help sense and respond to environmental conditions like microaerophilic conditions in CF mucus .

    5. Immune evasion: Some membrane proteins help pathogens evade host immune responses, potentially contributing to the persistent nature of B. cenocepacia infections.

    To investigate these possibilities, researchers could employ gene deletion studies similar to those conducted for BCAL2645, followed by phenotypic characterization of biofilm formation, antibiotic susceptibility, and virulence in appropriate model systems .

  • What experimental approaches are most effective for defining the membrane topology of Bcen2424_1283?

    Determining the membrane topology of Bcen2424_1283 requires complementary experimental approaches:

    1. Computational prediction: Initial topology models can be generated using algorithms like TMHMM, MEMSAT, or Phobius that predict transmembrane regions based on hydrophobicity.

    2. Cysteine scanning mutagenesis: Strategic introduction of cysteine residues followed by accessibility labeling with membrane-permeable and impermeable thiol-reactive reagents.

    3. Fusion reporter systems: Creating fusions with reporters like alkaline phosphatase (active in periplasm) or green fluorescent protein (active in cytoplasm) at various positions.

    4. Protease protection assays: Limited proteolysis of the protein in membrane vesicles, followed by mass spectrometry to identify protected regions.

    5. Antibody accessibility: Using antibodies against epitope tags inserted at different positions to determine which regions are accessible from different sides of the membrane.

    6. Fluorescence spectroscopy: Using fluorescence quenching to determine membrane boundaries when working with purified protein in artificial membrane systems.

    7. Cryo-electron microscopy: For high-resolution structural analysis if sufficient protein can be purified.

    The I-SceI homing endonuclease system, as described for creating the BCAL2645 mutant in B. cenocepacia K56-2, could be adapted for introducing mutations or tags into Bcen2424_1283 for topology studies .

  • How can researchers investigate potential interactions between Bcen2424_1283 and other B. cenocepacia proteins?

    Several approaches can be used to identify and characterize protein-protein interactions involving Bcen2424_1283:

    1. Co-immunoprecipitation (Co-IP): Using antibodies against Bcen2424_1283 or a fusion tag to pull down interacting proteins, similar to the two-way co-immunoprecipitation used to demonstrate interaction between NME1 and DNM2 proteins .

    2. Bacterial two-hybrid systems: Adapted for membrane proteins to detect interactions in vivo.

    3. Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify proteins in close proximity to Bcen2424_1283.

    4. Pull-down assays: Using purified tagged Bcen2424_1283 as bait to capture interacting partners from cell lysates.

    5. Surface plasmon resonance (SPR): For quantitative analysis of binding affinities between purified Bcen2424_1283 and candidate interacting proteins.

    6. Förster resonance energy transfer (FRET): For studying interactions in living bacterial cells.

    When analyzing results, researchers should consider:

    • The need for appropriate detergents to maintain membrane protein integrity

    • The possibility of transient or weak interactions that may be difficult to detect

    • The importance of validating interactions through multiple independent methods

    • The use of proper controls to distinguish specific from non-specific interactions

    The interactome of Bcen2424_1283 could provide valuable insights into its functional role in B. cenocepacia biology and pathogenesis.

  • What strategies can be employed to determine the function of uncharacterized membrane proteins like Bcen2424_1283?

    A systematic approach to characterizing Bcen2424_1283 function would include:

    1. Bioinformatic analysis:

      • Sequence homology searches to identify related proteins with known functions

      • Structural prediction to identify functional domains

      • Genomic context analysis to identify co-regulated genes

    2. Gene deletion/complementation studies:

      • Generation of B. cenocepacia mutants lacking Bcen2424_1283 using the I-SceI homing endonuclease system as described for BCAL2645

      • Phenotypic characterization of mutants for:

        • Growth in different media and stress conditions

        • Biofilm formation

        • Colony morphology

        • Antibiotic resistance

        • Virulence in infection models

      • Complementation with wild-type and mutated versions to confirm phenotypes

    3. Localization studies:

      • Fluorescent protein fusions to determine subcellular localization

      • Fractionation studies to confirm membrane association

    4. Transcriptomic/proteomic analysis:

      • RNA-seq to identify genes differentially expressed in the deletion mutant

      • Proteomic analysis to identify changes in the protein profile

    5. Biochemical characterization:

      • Purification of recombinant protein for in vitro studies

      • Testing for enzymatic activities based on bioinformatic predictions

      • Structural studies using X-ray crystallography or cryo-EM

    As demonstrated with the BCAL2645 protein, deletion mutants can reveal phenotypic changes that provide clues to protein function, such as altered biofilm formation, adherence to mucins, and invasion of human lung epithelial cells .

  • What considerations are important when designing constructs for structural studies of Bcen2424_1283?

    Structural studies of membrane proteins like Bcen2424_1283 require careful construct design:

    1. Boundaries optimization:

      • Identify stable, well-folded domains through limited proteolysis

      • Remove flexible regions that might impede crystallization

      • Consider multiple construct lengths with varying N- and C-termini

    2. Fusion protein strategy:

      • Select fusion partners that enhance expression and solubility

      • Consider fusion proteins known to facilitate membrane protein crystallization (e.g., T4 lysozyme, BRIL)

      • Position tags to minimize interference with protein function and crystallization

    3. Surface engineering:

      • Identify and mutate surface-exposed residues that might contribute to conformational heterogeneity

      • Consider thermostabilizing mutations to lock the protein in a specific conformation

      • Reduce surface entropy through lysine/glutamate to alanine mutations

    4. Expression screening:

      • Test multiple expression systems simultaneously

      • Optimize induction parameters for each construct

      • Screen for expression using GFP fusion to rapidly identify promising constructs

    5. Purification strategy:

      • Design two-step purification with orthogonal tags

      • Include protease sites for tag removal

      • Consider on-column detergent exchange capabilities

    Each construct should be evaluated for expression yield, stability in detergent, and monodispersity before proceeding to crystallization or cryo-EM studies.

  • How can computational approaches complement experimental studies of Bcen2424_1283?

    Computational methods provide valuable tools for studying proteins like Bcen2424_1283:

    1. Structure prediction:

      • Modern AI-based protein structure prediction tools like AlphaFold2 can provide reliable structural models of membrane proteins

      • These predictions can guide experimental design and interpretation

      • For Bcen2424_1283, structure prediction could identify potential functional sites and membrane topology

    2. Molecular dynamics simulations:

      • Simulate protein behavior in membrane environments

      • Identify conformational changes and potential binding sites

      • Test the effects of mutations on protein stability and function

    3. Virtual screening:

      • Identify potential binding partners or inhibitors

      • Prioritize compounds for experimental validation

      • Explore structure-activity relationships

    4. Genomic context analysis:

      • Identify genes consistently co-located with Bcen2424_1283 across bacterial species

      • Uncover potential functional relationships through gene neighborhood analysis

      • Compare conservation patterns across different bacterial lineages to infer evolutionary constraints

    5. Systems biology integration:

      • Incorporate Bcen2424_1283 into metabolic or protein interaction networks

      • Predict system-level effects of perturbations

      • Guide experimental validation of computational hypotheses

    The integration of computational and experimental approaches provides a powerful strategy for characterizing uncharacterized proteins like Bcen2424_1283, potentially accelerating discovery and reducing resource requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.