Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcenmc03_1254 (Bcenmc03_1254)

What is Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcenmc03_1254?

Bcenmc03_1254 is a membrane protein belonging to the UPF0060 protein family, derived from Burkholderia cenocepacia strain MC0-3. This protein consists of 110 amino acids and is produced as a recombinant protein typically expressed in E. coli for research purposes. According to protein databases, Bcenmc03_1254 has the UniProt ID B1JZ29 and is classified as part of the uncharacterized protein family UPF0060, which includes membrane proteins with similar structural characteristics across different bacterial species . The recombinant version can be produced with various tags, most commonly His-tags, to facilitate purification and downstream applications in research settings .

What are the known properties of the UPF0060 protein family?

The UPF0060 protein family represents a group of uncharacterized membrane proteins conserved across various bacterial species. Key properties include:

• Membrane localization with multiple predicted transmembrane domains

• Relatively small size (typically 100-120 amino acids)

• Conservation across diverse bacterial species including pathogenic and non-pathogenic organisms

• Relationship to the YnfA family of proteins based on domain analysis

While the precise biological functions remain incompletely characterized (hence the UPF designation - Uncharacterized Protein Family), structural analyses suggest these proteins may play roles in membrane integrity, transport processes, or signaling. Comparative genomics approaches indicate conservation of this protein family across different bacterial phyla, suggesting an important, possibly essential, cellular function .

What are the optimal expression systems for recombinant production of Bcenmc03_1254?

For successful recombinant production of Bcenmc03_1254, researchers should consider the following optimized expression strategy:

• Expression Host Selection: E. coli is the predominant host system used for recombinant production, as evidenced by commercial preparations . Specifically, E. coli strains designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) often yield better results than standard strains.

• Vector and Tag Selection: Vectors with inducible promoters (T7, tac) allow controlled expression. His-tagging is commonly employed for purification purposes, with the tag preferably positioned at the C-terminus to avoid interference with signal peptide processing .

• Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve proper folding

  • Induction: Milder induction with lower IPTG concentrations (0.1-0.5 mM)

  • Media supplementation: Addition of glycerol (0.5-1%) can support membrane protein expression

• Extraction and Purification:

  • Membrane fraction isolation using ultracentrifugation

  • Solubilization with mild detergents (DDM, LDAO, or Fos-choline)

  • Purification via IMAC (immobilized metal affinity chromatography) for His-tagged proteins

This methodological approach has been successfully applied for producing recombinant UPF0060 family proteins suitable for downstream structural and functional studies .

How can researchers assess the membrane topology of Bcenmc03_1254?

To comprehensively determine the membrane topology of Bcenmc03_1254, researchers should employ multiple complementary experimental approaches:

• Computational Prediction:

  • Hydropathy analysis and transmembrane domain prediction using algorithms like TMHMM, Phobius, or TOPCONS

  • Comparison with known topology of homologous proteins like MMAR_2961 from Mycobacterium marinum

• Experimental Validation:

  • Fusion Reporter Approach: Creating fusion constructs with reporters like PhoA (alkaline phosphatase) or GFP at different positions. PhoA is active only when located in the periplasm, while GFP fluorescence is observed only when the protein is in the cytoplasm.

  • Cysteine Accessibility Method: Introducing cysteine residues at specific positions and testing their accessibility to membrane-impermeable sulfhydryl reagents.

  • Protease Protection Assays: Limited proteolysis combined with mass spectrometry to identify membrane-protected regions.

• Structural Biology Approaches:

  • Cryo-electron microscopy of membrane-embedded protein

  • NMR spectroscopy with isotope-labeled protein

By combining these methodologies, researchers can generate a detailed topological map of Bcenmc03_1254, identifying which portions of the protein face the cytoplasm, which regions span the membrane, and which segments are exposed to the periplasm or extracellular environment .

What potential roles might Bcenmc03_1254 play in Burkholderia cenocepacia pathogenesis?

While specific functions of Bcenmc03_1254 in pathogenesis remain to be fully elucidated, several potential roles can be hypothesized based on its properties as a membrane protein in B. cenocepacia, an opportunistic pathogen significant in cystic fibrosis patients :

• Membrane Integrity and Adaptation: As a membrane protein, it may contribute to maintaining membrane structure under the stressful conditions encountered during infection, including antimicrobial peptides, pH changes, and oxidative stress.

• Transport Functions: Many small membrane proteins facilitate transport of specific molecules across bacterial membranes, which could include nutrients, signaling molecules, or antimicrobial resistance compounds.

• Secretion System Support: B. cenocepacia utilizes a type VI secretion system for bacterial competition and possibly host interactions . Bcenmc03_1254 might function as an accessory protein supporting this secretion machinery.

• Biofilm Formation: Membrane proteins often contribute to cell surface properties that influence bacterial aggregation and biofilm development, critical virulence factors for B. cenocepacia.

Methodological approaches to investigate these roles include:

• Generation of knockout mutants followed by virulence assessment in appropriate models

• Transcriptomic analysis comparing expression under host-mimicking versus standard conditions

• Protein-protein interaction studies to identify binding partners within secretion systems

• Membrane permeability assays comparing wild-type and mutant strains

The connection between Bcenmc03_1254 and the type VI secretion system is particularly intriguing, as this secretion system has been implicated in the competitive fitness of B. cenocepacia in polymicrobial infections .

How does Bcenmc03_1254 compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis of Bcenmc03_1254 with other UPF0060 family proteins reveals important structural and potential functional relationships:

The sequence of MMAR_2961 from Mycobacterium marinum (MVVRSILLFIVAAVAEIGGAWLVWQGVREQRGLAWIGAGVIALGLYGFVATLQPDAHFGRILAAYGGIFVAGSLLWGMAFDGFRPDRADIVGALVCLAGVGVIMYAPRAH) shows structural similarities to Bcenmc03_1254, suggesting conservation of function across these different bacterial species .

Methodological approaches for comparative functional analysis include:

• Heterologous complementation studies to determine if proteins from different species can substitute for each other

• Construction of chimeric proteins to identify functionally important domains

• Comparative structural modeling based on available structural data

• Cross-species protein-protein interaction studies

These comparative approaches can provide valuable insights into conserved functions of UPF0060 family proteins and may help elucidate the specific roles of Bcenmc03_1254 in B. cenocepacia .

What protein-protein interaction methods are most effective for identifying Bcenmc03_1254 binding partners?

For comprehensive identification of Bcenmc03_1254 interaction partners, researchers should implement a multi-faceted approach optimized for membrane proteins:

• Proximity-based Labeling:

  • BioID approach: Fusion of Bcenmc03_1254 with a biotin ligase (BirA*) to biotinylate proximal proteins

  • APEX2 method: Peroxidase-based proximity labeling followed by streptavidin pull-down and mass spectrometry

  • These methods are particularly valuable for membrane proteins as they capture transient interactions in native conditions

• Cross-linking Mass Spectrometry (XL-MS):

  • Chemical cross-linking of intact bacterial cells or membrane fractions

  • Digestion and enrichment of cross-linked peptides

  • High-resolution mass spectrometry for cross-link identification

  • Data analysis with specialized software (e.g., pLink, Kojak, or XlinkX)

• Membrane-specific Two-hybrid Systems:

  • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system, specifically designed for membrane protein interactions

  • Split-ubiquitin yeast two-hybrid system adapted for membrane proteins

• Co-purification Approaches:

  • Tandem affinity purification with gentle detergent solubilization

  • Label-free quantitative proteomics comparing specific vs. control pull-downs

  • SWATH-MS for improved sensitivity in detecting membrane protein complexes

Systematic application of these methods can reveal both stable and transient interaction partners of Bcenmc03_1254, potentially connecting it to known cellular processes or secretion systems in B. cenocepacia.

How can researchers effectively analyze the role of Bcenmc03_1254 in bacterial membrane dynamics?

To investigate the role of Bcenmc03_1254 in membrane dynamics, researchers should employ multiple complementary approaches:

• Fluorescent Lipid Probe Studies:

  • Incorporation of environment-sensitive probes (Laurdan, DPH) into membranes

  • Comparison of membrane fluidity and organization between wild-type and Bcenmc03_1254 mutant strains

  • Fluorescence anisotropy and generalized polarization measurements

• Biophysical Membrane Characterization:

  • Differential scanning calorimetry to measure phase transition temperatures

  • Atomic force microscopy to visualize nanoscale membrane organization

  • Solid-state NMR to analyze lipid ordering in the presence/absence of the protein

• Reconstitution Studies:

  • Purification of Bcenmc03_1254 and reconstitution into liposomes of defined composition

  • Measurement of effects on membrane permeability, curvature, and domain formation

  • Comparison with related UPF0060 family proteins from other bacteria

• In vivo Imaging Approaches:

  • Super-resolution microscopy (PALM/STORM) of fluorescently-tagged Bcenmc03_1254

  • FRAP (Fluorescence Recovery After Photobleaching) analysis to measure protein mobility

  • Co-localization studies with other membrane proteins and lipid domain markers

These methodologies can reveal whether Bcenmc03_1254 influences membrane organization, fluidity, permeability, or domain formation, providing insights into its cellular function in B. cenocepacia.

How can multi-omics data be integrated to understand the role of Bcenmc03_1254 in Burkholderia cenocepacia?

A comprehensive multi-omics approach to elucidate Bcenmc03_1254 function should include:

• Comparative Genomics:

  • Analysis of gene neighborhood conservation across Burkholderia species

  • Identification of co-evolution patterns with other genes

  • Phylogenetic profiling to find functional associations

• Transcriptomic Integration:

  • RNA-seq comparing wild-type and Bcenmc03_1254 knockout strains under various conditions

  • Co-expression network analysis to identify functionally related genes

  • Identification of transcription factors potentially regulating Bcenmc03_1254

• Proteomic Approaches:

  • Quantitative proteomics of membrane fractions from wild-type versus knockout strains

  • Phosphoproteomics to identify potential signaling pathways affected

  • Protein turnover analysis to determine stability and regulation

• Metabolomic Analysis:

  • Targeted and untargeted metabolomics comparing wild-type and mutant strains

  • Focus on membrane-associated metabolites and lipid composition

  • Flux analysis using isotope-labeled precursors

• Integrated Data Analysis:

  • Network-based integration of multi-omics data

  • Machine learning approaches to identify patterns across datasets

  • Pathway enrichment analysis across multiple data types

This integrated approach can place Bcenmc03_1254 within the broader cellular context of B. cenocepacia and potentially identify its role in important processes such as virulence, metabolism, or stress response.

What statistical approaches are most appropriate for analyzing data from Bcenmc03_1254 functional studies?

When analyzing experimental data related to Bcenmc03_1254 function, researchers should employ these statistical approaches:

• For Growth and Phenotypic Assays:

  • Mixed-effects models to account for batch variations

  • Survival analysis for time-to-event data (e.g., antibiotic resistance)

  • ANOVA with appropriate post-hoc tests for multi-condition comparisons

• For Protein-Protein Interaction Studies:

  • Significance Analysis of INTeractome (SAINT) algorithm for mass spectrometry data

  • Permutation-based statistical testing to establish confidence thresholds

  • Bayesian approaches to assign probability scores to potential interactions

• For Transcriptomic/Proteomic Studies:

  • Limma-voom or DESeq2 for differential expression analysis

  • Gene set enrichment analysis with appropriate multiple testing correction

  • Weighted gene co-expression network analysis (WGCNA) for module identification

• For Structure-Function Studies:

  • Bayesian statistical approaches for model comparison

  • Bootstrap analysis for estimating confidence in structural predictions

  • Correlation analysis between structural features and functional outcomes

• Visualization and Reporting:

  • Principal component analysis for dimensionality reduction

  • Hierarchical clustering with bootstrapping for reliability assessment

  • Effect size reporting alongside p-values to indicate biological significance

What are the most promising future research directions for understanding Bcenmc03_1254 function?

Based on current knowledge, several high-priority research directions for Bcenmc03_1254 include:

• Structure-Function Relationship Elucidation:

  • High-resolution structural determination using cryo-EM or X-ray crystallography

  • Systematic mutagenesis of conserved residues across UPF0060 family members

  • Computational molecular dynamics simulations to predict functionally important regions

• Connection to Virulence Mechanisms:

  • Investigation of Bcenmc03_1254's potential role in the type VI secretion system of B. cenocepacia

  • Assessment of Bcenmc03_1254 contribution to biofilm formation and antibiotic resistance

  • Evaluation of the protein's impact on bacterial survival in host-relevant conditions

• Comparative Biology Approaches:

  • Functional complementation studies across different bacterial species

  • Investigation of UPF0060 family proteins in non-pathogenic bacteria to understand conserved functions

  • Evolutionary analysis to identify selective pressures on this protein family

• Therapeutic Targeting Potential:

  • Assessment of Bcenmc03_1254 as a potential drug target

  • Development of specific inhibitors or antibodies against the protein

  • Evaluation of effects in B. cenocepacia infection models

These research directions can collectively advance our understanding of this previously uncharacterized membrane protein and potentially reveal new insights into B. cenocepacia pathogenesis and bacterial membrane protein biology in general.

How can contradictory experimental results regarding Bcenmc03_1254 function be reconciled?

When facing contradictory results in Bcenmc03_1254 research, implement this systematic approach:

• Methodological Reconciliation:

  • Compare experimental conditions in detail (strains, growth conditions, media composition)

  • Evaluate differences in protein tagging strategies that might affect function

  • Consider membrane extraction methods that could differentially preserve protein interactions

  • Assess the temporal aspects of experiments (growth phase, induction timing)

• Context-Dependent Function Analysis:

  • Test whether Bcenmc03_1254 exhibits different functions under different environmental conditions

  • Investigate potential post-translational modifications that might switch protein function

  • Examine strain-specific differences in genomic context that might affect protein function

• Integrative Data Analysis:

  • Implement Bayesian integration of conflicting datasets with appropriate weighting

  • Use meta-analysis approaches when multiple studies are available

  • Develop computational models that might explain seemingly contradictory observations

• Targeted Validation Experiments:

  • Design experiments specifically addressing the contradiction points

  • Implement orthogonal methodologies to test the same functional hypothesis

  • Consider the use of in vitro reconstitution to control for cellular context variables

This methodological framework enables researchers to address experimental contradictions systematically, potentially revealing context-dependent functions or technical factors influencing experimental outcomes.