Recombinant Burkholderia cepacia Fusaric acid resistance protein FusC (fusC)

Shipped with Ice Packs
In Stock

Description

Overview of FusC

FusC is a fusaric acid resistance protein encoded by the fusC gene in Burkholderia cepacia complex (BCC) species. It functions as part of a tetrapartite efflux pump system, which includes outer membrane, periplasmic, and inner membrane components . Recombinant FusC is produced in Escherichia coli for experimental applications, typically fused with a His-tag for purification .

Genetic Organization

The fusC gene is co-localized within the fusR-bucl8-fusCDE operon in Burkholderia species . This operon includes:

  • fusR: A LysR-type transcriptional regulator.

  • bucl8: Encodes an outer membrane collagen-like protein.

  • fusC, fusD, fusE: Components of the FA efflux pump .

Protein Structure

FusC is a 346-amino acid protein (UniProt ID: P24128) with the following features :

PropertyDetail
Molecular Weight~38 kDa (calculated)
DomainsPredicted transmembrane domains for efflux activity
Recombinant FormFull-length protein with N-terminal His-tag, expressed in E. coli
Structural ConfirmationCollagen-like triple-helix motif (via circular dichroism spectroscopy)

Mechanism of Fusaric Acid Resistance

FusC operates within a tripartite or tetrapartite efflux pump to extrude FA:

  • Induction: FA upregulates fusC expression via the transcriptional activator FusR .

  • Efflux Function: FusC collaborates with FusD (membrane fusion protein) and FusE (inner membrane transporter) to transport FA across the cell envelope .

  • Impact of Deletion: Knockout of the fusC locus reduces FA resistance by 4-fold in Burkholderia pseudomallei, confirming its critical role .

Key Studies

  • FA Resistance in Heterologous Hosts: Expression of the FusC-associated pump in E. coli conferred FA resistance, validating its functional conservation .

  • Substrate Specificity: Unlike other Burkholderia efflux pumps (e.g., RND-3/4), FusC does not contribute to broad-spectrum antibiotic resistance, highlighting its niche role in FA detoxification .

  • Transcriptional Regulation: Exogenous FA induces fusC transcription over 80-fold, while p-hydroxybenzoic acid (pHBA) also modulates expression .

Table: Functional Comparison with Other Efflux Pumps

Efflux SystemComponentsSubstratesRole in Resistance
FusC-FusD-FusEFusC (OM), FusD, FusEFusaric acidMycotoxin resistance
RND-3/4RND transportersAntibiotics, chlorhexidineMultidrug resistance
BcrAMFS transporterTetracycline, nalidixic acidAntibiotic resistance

Applications of Recombinant FusC

  • Biochemical Studies: Used to characterize FA binding and efflux kinetics .

  • Antimicrobial Development: Serves as a target for disrupting FA resistance in pathogenic Burkholderia strains .

  • Structural Biology: The recombinant protein aids in resolving the collagen-like domain’s role in fibrinogen binding .

Future Directions

  • Mechanistic Studies: Elucidate FusC’s interaction with FA at atomic resolution.

  • Ecological Impact: Assess FusC’s role in Burkholderia-Fusarium interactions in agricultural settings.

  • Therapeutic Potential: Explore FusC inhibitors to enhance FA’s efficacy as an antifungal agent.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences you may have. Please indicate your requirements when placing your order, and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for the most accurate delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. For reconstitution, please use deionized sterile water to achieve a protein concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
fusC; Fusaric acid resistance protein FusC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-346
Protein Length
full length protein
Species
Burkholderia cepacia (Pseudomonas cepacia)
Target Names
fusC
Target Protein Sequence
MSAMTRVSEVIIGIVSAGVVSALVFPRYTGEQMRTTVRKRFGSFVDYVASALSGQLDRAH IETIHTRFAYVVGFEAARSMAVFEDPDTRMRSGRLARLNSEFMSASSRFHALHQLMNRLH AAGAQAAIDAIEPYFREIAPLLTRNGEPVRTSIDAAHSAEQLLAWRDALPRRIRATRAEL ETQPDFPLLDFDTAAELLYRFITDLQEYAATYASLATATHERERWIERYEPRTNKTAATI AGIRTATVILALGWFWIETAWPSGVMLVLNAAATCALASSAPRPTAMAAQMGMGTALAVC TGFLLTFGIYPRIDGFVLLCAALAPLLAIGIYMSLKPKLAGYGGAI
Uniprot No.

Target Background

Function
FusC plays a crucial role in the resistance (detoxification) of the fungal toxin fusaric acid.
Protein Families
Aromatic acid exporter ArAE (TC 2.A.85) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is fusaric acid and why is resistance to it important?

Fusaric acid (5-butylpicolinic acid) is a mycotoxin produced by several Fusarium species. It exhibits strong phytotoxicity against plants and moderate toxicity to animal cells . As a picolinic acid derivative, it functions as an antibiotic (wilting agent) that was first isolated from Fusarium heterosporium .

Fusaric acid significantly contributes to the virulence of Fusarium oxysporum on both plant and mammalian hosts. Research has shown that targeted deletion of fusaric acid biosynthesis genes reduces pathogen virulence, with severity of vascular wilt symptoms in plants and mortality in immunosuppressed mice being significantly decreased in fusaric acid-deficient mutants .

Resistance to fusaric acid is important because:

  • It allows bacteria like Burkholderia to cohabitate soil environments with Fusarium species

  • It may provide competitive advantages in microbial communities

  • It contributes to bacterial survival in environments with fusaric acid-producing fungi

  • Understanding resistance mechanisms may provide insights into microbial interactions in the rhizosphere

How is the fusC gene organized within the bacterial genome?

The fusC gene is part of an operon structure that resembles a classical efflux pump organization. Based on the search results, there are similarities in organization patterns between fusaric acid resistance systems across different bacterial species:

  • In Burkholderia species, a collagen-like protein (Bucl8) has been identified as the outer membrane component of an efflux pump responsible for fusaric acid resistance. The gene organization includes:

    • The bucl8 gene co-localized with downstream fusCDE genes encoding fusaric acid resistance

    • An upstream gene designated as fusR, encoding a LysR-type transcriptional regulator

  • In Stenotrophomonas maltophilia, a fusaric acid resistance-involved regulon was identified:

    • fuaR-fuaABC operon, where fuaR functions as a regulator

    • The fuaABC operon is inducibly expressed by fusaric acid

    • FuaR functions as a repressor of the fuaABC operon in the absence of fusaric acid inducer and as an activator in its presence

The genomic organization of these resistance systems typically includes regulatory elements, membrane components, and other proteins necessary for the functional efflux machinery.

How do fusaric acid efflux systems function in different bacterial species?

Fusaric acid resistance is mediated by specialized efflux pump systems that vary across bacterial species. Current research reveals several distinct systems:

Table 1: Comparison of Fusaric Acid Resistance Systems Across Bacterial Species

Bacterial SpeciesSystem NameComponentsRegulatory MechanismKey Features
Burkholderia speciesBucl8-FusCDEBucl8 (outer membrane), FusCDE (additional components)FusR (LysR-type regulator)Tetrapartite efflux pump; Bucl8 has collagen-like domain that binds fibrinogen
Stenotrophomonas maltophiliaFuaABCFuaA, FuaB, FuaCFuaR (AraC-type regulator)Tripartite efflux pump; inducibly expressed by fusaric acid
Burkholderia ambifariaFua systemMultiple proteinsUnknownAssociated with fusaric acid catabolism; includes FMN-dependent luciferase-like monooxygenase

The functional efflux systems exhibit several key characteristics:

  • Inducible expression in response to fusaric acid exposure

  • Regulatory control by specialized transcription factors

  • Multi-component structure spanning the bacterial cell envelope

  • Specificity for fusaric acid and potentially related compounds

Research indicates that these systems may have evolved specifically to counter the toxic effects of fusaric acid in environments where bacteria coexist with Fusarium species .

What experimental approaches can be used to investigate FusC function?

Several experimental approaches can be employed to investigate FusC function:

  • Genetic Manipulation:

    • Construction of knockout mutants (ΔfusC) using techniques such as:

      • PCR amplification of regions flanking the target gene

      • Cloning into appropriate vectors (e.g., pEX18Tc, pGPI-SceI)

      • Introduction by triparental mating

      • Selection of double-crossover mutants

    • Complementation studies with wild-type gene to confirm phenotype restoration

  • Susceptibility Testing:

    • Determination of Minimum Inhibitory Concentration (MIC) using standard agar dilution method:

      • Testing fusaric acid alone or in combination with other compounds

      • Using carbonyl cyanide 3-chlorophenylhydrazone (CCCP) as an efflux pump inhibitor control

      • Comparing wild-type, mutant, and complemented strains

  • Expression Analysis:

    • Reverse transcriptase-PCR (RT-PCR) to verify operon structure

    • RT-qPCR to quantify gene expression changes in response to fusaric acid

    • Promoter transcription fusion assays to assess regulatory mechanisms

  • Heterologous Expression:

    • Expression of the FusC system in a heterologous host (e.g., E. coli)

    • Assessment of conferred resistance in the heterologous system

  • Protein Characterization:

    • Recombinant protein production with appropriate tags

    • Purification using affinity chromatography

    • Functional assays to assess activity

    • Structural studies (e.g., circular dichroism for secondary structure analysis)

What analytical methods can be used to detect and quantify fusaric acid in experimental samples?

Accurate detection and quantification of fusaric acid is essential for studying resistance mechanisms. The following analytical methods have been successfully employed:

  • Ultra-Performance Liquid Chromatography (UPLC):

    • Sample preparation: Simple extraction with methanol

    • Conditions:

      • Mobile phase: 20:80 (v/v) water/acetonitrile containing 0.1% formic acid

      • Flow rate: 0.05 ml/min

      • Injection volume: 1 μl

      • Detection: UV at 220 nm

    • Run time: Only 8 minutes (much shorter than conventional methods)

    • Linear range: 1-200 μg/ml with correlation coefficient R² > 0.99

    • Recovery efficiencies: >98.2% from Fusarium cultures; 79.1-105.8% from food/feed products

    • Precision: R.S.D. <3.0% for Fusarium samples; <10% for food/feed products

Table 2: Optimized UPLC Parameters for Fusaric Acid Detection

ParameterOptimal ValueAlternative Values TestedEffect
Mobile phase composition (A:B)20:8010:90, 30:7020:80 provided minimum retention time (6.61 min) and narrowest peak width (14.8s)
Flow rate (ml/min)0.050.02, 0.070.05 balanced resolution and run time
Injection volume (μl)12, 31 μl provided sufficient sensitivity with minimal band broadening
Column pressure~4400 psi-Stable without significant fluctuations
Detection wavelength220 nm-Optimal for fusaric acid absorption

This method has been validated for both fungal cultures and various food products, demonstrating excellent sensitivity, precision, and recovery .

How do fusaric acid resistance systems contribute to bacterial fitness in different environments?

Fusaric acid resistance systems contribute to bacterial fitness in multiple ways:

  • Soil Environment Adaptation:

    • Allows bacteria like Burkholderia to cohabitate with Fusarium species in soil

    • Provides competitive advantage in microbial communities where fusaric acid is present

  • Growth Optimization:

    • Deletion of the bucl8-locus drastically affects bacterial growth in laboratory media

    • The efflux system appears to contribute to optimal growth even in standard conditions

  • Additional Functional Roles:

    • Beyond fusaric acid resistance, some components like Bucl8 have dual functions:

      • The collagen-like domain adopts a triple-helical structure

      • Can bind to fibrinogen, potentially contributing to interactions with hosts

  • Rhizosphere Interactions:

    • Fusaric acid mediates the assembly of disease-suppressive microbiota in the plant rhizosphere

    • Bacterial resistance systems may influence these interactions and community composition

  • Response to Plant-Pathogen Dynamics:

    • Fusaric acid contributes to virulence of Fusarium on both plant and mammalian hosts

    • Bacterial resistance systems may alter the dynamic between plants, pathogens, and beneficial microbes

Notably, research has shown that while the Bucl8-associated pump confers fusaric acid resistance, it does not confer resistance to a panel of clinically-relevant antimicrobials in Burkholderia and E. coli, suggesting a specialized role in fusaric acid detoxification rather than broad antimicrobial resistance .

What are the optimal conditions for storing and handling Recombinant FusC protein?

For optimal results with Recombinant Burkholderia cepacia Fusaric acid resistance protein FusC, researchers should follow these storage and handling recommendations:

  • Storage Conditions:

    • Store at -20°C for regular storage

    • For extended storage, conserve at -20°C or -80°C

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freezing and thawing cycles

  • Buffer Composition:

    • Typically supplied in Tris-based buffer with 50% glycerol, optimized for protein stability

    • Buffer composition may be adjusted based on specific experimental needs

  • Handling Precautions:

    • Thaw protein samples on ice

    • Centrifuge briefly before opening to collect liquid at the bottom of the tube

    • Use appropriate sterile techniques to prevent contamination

    • Consider adding protease inhibitors for sensitive applications

  • Quality Control Considerations:

    • Verify protein purity by SDS-PAGE (typically ≥85% for research-grade preparations)

    • For functional studies, include appropriate positive and negative controls

How can researchers generate knockout mutants to study FusC function?

Generation of fusC knockout mutants involves several sophisticated molecular techniques:

  • Construction of Deletion Plasmids:

    • Amplify DNA regions flanking the fusC gene using specific primer pairs

    • Design primers with appropriate restriction sites for subsequent cloning

    • Clone amplicons into a suitable suicide vector (e.g., pEX18Tc)

  • Mutant Generation Strategies:

    • Double-Crossover Method:

      • Introduce the recombinant plasmid into bacteria via conjugation

      • Select for integration using appropriate antibiotics

      • Counter-select for resolution of the integrated plasmid

      • Screen for gene deletion by PCR

    • I-SceI-Based System:

      • Clone deletion construct into pGPI-SceI

      • Introduce plasmid via triparental mating

      • Verify integration by PCR

      • Resolve co-integrate by introducing pDAI-SceI

      • Screen for loss of resistance marker

      • Verify deletion by PCR

  • Verification of Mutants:

    • Use PCR with primers flanking the deletion site to confirm gene removal

    • Sequence the junction regions to ensure in-frame deletion

    • Perform RT-PCR to confirm absence of transcript

  • Complementation Studies:

    • Clone the wild-type gene into an expression vector

    • Introduce the construct into the deletion mutant

    • Verify restoration of the wild-type phenotype

What susceptibility testing protocols can be used to evaluate fusaric acid resistance?

Researchers can employ the following protocols to evaluate fusaric acid resistance:

  • Standard Agar Dilution Method:

    • Prepare Mueller-Hinton agar plates containing serial dilutions of fusaric acid

    • Inoculate plates with standardized bacterial suspensions

    • Incubate at 37°C for 18 hours

    • Determine MIC as the lowest concentration inhibiting visible growth

  • Enhanced Testing Approaches:

    • Test fusaric acid alone or in combination with:

      • CCCP (10 mg/L) as an efflux pump inhibitor

      • Other antimicrobials to assess cross-resistance

  • Growth Rate Analysis:

    • Monitor bacterial growth in liquid media containing sub-inhibitory concentrations of fusaric acid

    • Measure optical density at regular intervals

    • Calculate growth parameters (lag phase, doubling time, maximum OD)

  • Heterologous Expression Testing:

    • Express the putative resistance genes in a susceptible heterologous host (e.g., E. coli)

    • Compare growth of the recombinant strain versus control in the presence of fusaric acid

  • Metal Ion Interaction Studies:

    • Test fusaric acid resistance in the presence of various metal ions (copper, iron, zinc)

    • These metals may affect fusaric acid toxicity due to its potential chelating properties

A comprehensive assessment should include both wild-type and mutant strains, with appropriate controls and replicates to ensure reproducibility and statistical significance.

How does FusC research inform our understanding of plant-microbe-pathogen interactions?

Research on FusC and related fusaric acid resistance systems provides valuable insights into complex plant-microbe-pathogen interactions:

  • Rhizosphere Microbiota Assembly:

    • Fusaric acid mediates the assembly of disease-suppressive microbiota in the rhizosphere

    • Understanding bacterial resistance mechanisms helps explain how beneficial microbes persist in the presence of this mycotoxin

  • Tripartite Interactions:

    • Plant-pathogen-microbiota interactions in the rhizosphere determine plant health status

    • Fusaric acid produced by pathogens like Fusarium oxysporum triggers systemic changes in the rhizosphere microbiota

    • Resistant bacteria may influence these dynamics differently in resistant versus susceptible plant genotypes

  • Root Exudation Responses:

    • Fusaric acid induces changes in plant root exudation

    • These changes directly affect recruitment of specific disease-suppressive taxa

    • Bacteria with fusaric acid resistance may play key roles in these protective microbial communities

  • Cross-Kingdom Pathogenesis:

    • Fusaric acid contributes to Fusarium virulence on both plant and mammalian hosts

    • Understanding how bacteria resist this toxin may provide insights into mechanisms of pathogen resistance and virulence modulation

What potential biotechnological applications exist for FusC and related proteins?

Fusaric acid resistance proteins like FusC have several potential biotechnological applications:

  • Agricultural Biocontrol:

    • Development of fusaric acid-resistant bacterial strains as biocontrol agents against Fusarium diseases

    • Engineering beneficial microbes with enhanced fusaric acid resistance for improved persistence in pathogen-infested soils

  • Bioremediation:

    • Some bacteria can use fusaric acid as a sole carbon, nitrogen, and energy source

    • Engineered systems based on fusaric acid resistance/degradation pathways could help remediate contaminated agricultural soils

  • Biosensors:

    • Development of biosensors for fusaric acid detection based on inducible expression systems

    • Potential applications in food safety monitoring and agricultural diagnostics

  • Protein Engineering:

    • The dual functionality of some components (e.g., Bucl8's fibrinogen binding) could be exploited for protein engineering applications

    • Development of novel binding proteins or scaffolds based on structural features of fusaric acid resistance proteins

  • Mycotoxin Detection Systems:

    • Recombinant FusC could potentially be incorporated into detection systems for fusaric acid in agricultural products

    • These systems could help monitor food and feed safety

How can FusC research contribute to antimicrobial resistance studies?

While FusC-type systems appear specialized for fusaric acid rather than clinical antibiotics, this research still offers valuable insights for antimicrobial resistance studies:

  • Novel Efflux Mechanisms:

    • FusC is part of a potentially novel type of tripartite/tetrapartite efflux pump

    • Understanding its structure and function may provide insights into other efflux systems relevant to antimicrobial resistance

  • Regulatory Networks:

    • The regulation of fusaric acid resistance systems (e.g., by FuaR or FusR) could reveal principles applicable to regulation of other resistance systems

    • Insights into how bacteria sense and respond to environmental toxins

  • Specialized vs. Broad-Spectrum Resistance:

    • FusC-type systems appear specialized for fusaric acid and don't confer broad resistance to clinical antimicrobials

    • Understanding this specificity may help design more targeted antimicrobial agents less prone to cross-resistance

  • Environmental Reservoirs:

    • Soil bacteria like Burkholderia species can be environmental reservoirs of resistance genes

    • Understanding specialized resistance systems may help distinguish between environmental adaptation and clinically relevant resistance

  • Methodological Approaches:

    • Techniques developed to study fusaric acid resistance (gene deletion, complementation, susceptibility testing) are directly applicable to studies of clinical antimicrobial resistance

What are common technical challenges when working with recombinant FusC and how can they be addressed?

Researchers working with recombinant FusC may encounter several technical challenges:

  • Protein Solubility and Stability:

    • Challenge: As a membrane-associated protein, FusC may have solubility issues when expressed recombinantly.

    • Solution: Optimize expression conditions (temperature, induction time, media composition); use solubility-enhancing tags; include appropriate detergents or membrane-mimetic systems for purification and storage

  • Functional Characterization:

    • Challenge: Demonstrating specific activity of the recombinant protein.

    • Solution: Develop appropriate in vitro assays; consider reconstitution in liposomes or nanodiscs for membrane proteins; use heterologous expression systems to confirm function

  • Protein Purity:

    • Challenge: Achieving high purity for sensitive applications.

    • Solution: Implement multi-step purification protocols; consider size exclusion chromatography as a final polishing step; verify purity by SDS-PAGE and mass spectrometry

  • Storage Stability:

    • Challenge: Maintaining protein activity during storage.

    • Solution: Store in optimized buffer with 50% glycerol at -20°C or -80°C; prepare small aliquots to avoid freeze-thaw cycles; include stabilizing agents if necessary

  • Functional Reconstitution:

    • Challenge: Reconstituting the complete efflux system for functional studies.

    • Solution: Co-express multiple components; use membrane mimetics appropriate for multi-protein complexes; consider cell-based assays instead of purified systems

How can researchers effectively design experiments to study FusC in the context of complete efflux systems?

Studying FusC in the context of complete efflux systems requires thoughtful experimental design:

By implementing these approaches, researchers can gain comprehensive insights into how FusC functions within the complete fusaric acid resistance system, providing a more holistic understanding of this specialized bacterial defense mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.