Recombinant Burkholderia cepacia Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; BceJ2315_04250; BCAL0426; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315))
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRDHGRPSMFFPSATHTAPAAAGGASGTGATTAGDVP AAAAGAAPSTTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITLFD HTAGHTYLARTGLLGGDFPNHNDVYTQLNPGSTSLTGDQNTLKLSFESPVKGGVKVVKTY TFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQ KIDFSDLDKNKANFEKSADNGWVAMVQHYFASAWIPQQGAKRDIYAEKIDPALYRVGVKQ PVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHGY VGNWGWAIVLLTVLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAALME LYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPFFILPVL MAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYI TRKLGGVKKKPA
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic role of YidC in Burkholderia cepacia?

YidC in Burkholderia cepacia functions as a membrane protein insertase that catalyzes the insertion of proteins into the prokaryotic plasma membrane. Unlike the Sec translocase which operates as a transmembrane channel, YidC interacts with substrate proteins in a groove-like structure at an amphiphilic protein-lipid interface. This distinctive mechanism allows transmembrane segments of substrate proteins to slide directly into the lipid bilayer . Within the Burkholderia cepacia complex (Bcc), YidC plays a critical role in membrane protein biogenesis and proper folding, which is essential for bacterial survival and pathogenicity.

The insertase functions by facilitating the transition of transmembrane proteins from the aqueous cytoplasmic environment to the hydrophobic environment of the lipid bilayer . This process is particularly important in Bcc species, which are known to have complex cell envelopes that contribute to their intrinsic antibiotic resistance and survival in diverse environments .

How does YidC structure vary across Burkholderia cepacia complex species?

The Burkholderia cepacia complex comprises multiple closely related genomovars or species, with at least 9 genomovars currently described . While the high-resolution structures of YidC provide general mechanistic insights , specific structural variations of YidC across different Bcc species remain an area requiring further investigation.

The high level of homologous recombination between Bcc species (with 67.1% of recombination events occurring between species rather than within species) suggests there may be variations in YidC structure that reflect adaptive pressures specific to different ecological niches. B. cenocepacia and B. multivorans, which account for approximately 90% of Bcc isolates from cystic fibrosis sputum , may exhibit specific YidC structural adaptations related to their pathogenicity in the human respiratory environment.

What are the optimal expression systems for producing recombinant Burkholderia cepacia YidC?

When expressing recombinant Burkholderia cepacia YidC, researchers should consider several experimental factors:

  • Expression Host Selection: E. coli C41(DE3) or C43(DE3) strains are often preferred for membrane protein expression due to their adaptations that prevent toxicity from overexpression.

  • Vector System: IPTG-inducible pET vectors with a C-terminal His-tag are commonly used, though the tag position should be optimized to avoid interference with protein function.

  • Growth Conditions:

    • Temperature: Lower temperatures (16-20°C) after induction reduce inclusion body formation

    • Media: Enriched media such as Terrific Broth with glycerol supplementation can enhance yield

    • Induction: Gradual induction with low IPTG concentrations (0.1-0.5 mM) typically produces better results

  • Detergent Selection: A comparative screening approach using multiple detergents (DDM, LMNG, LDAO) is recommended to identify optimal solubilization conditions that maintain the native conformation of YidC.

Given the high recombination rate observed in the Bcc core genome (5.8% of core orthologous genes showing recombination) , researchers should verify their yidC sequence after cloning to ensure it matches the expected sequence from their specific Bcc strain.

What methodology should be used to study interactions between YidC and substrate proteins in Burkholderia cepacia?

A multi-faceted experimental approach is recommended to comprehensively characterize YidC-substrate interactions:

  • In vivo crosslinking:

    • Chemical crosslinkers such as DSP (dithiobis(succinimidyl propionate)) can capture transient interactions

    • Site-specific photocrosslinking using unnatural amino acids (e.g., p-benzoyl-L-phenylalanine) incorporated at predicted interaction sites provides spatial resolution of binding interfaces

  • Co-purification assays:

    • Tandem affinity purification (TAP) using differently tagged YidC and substrate proteins

    • Native PAGE analysis to preserve weak protein-protein interactions

  • Biophysical characterization:

    • Isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamic parameters

    • Microscale thermophoresis (MST) for interaction studies in membrane-mimetic environments

  • Structural approaches:

    • Cryo-electron microscopy of YidC-substrate complexes in nanodiscs

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to map interaction regions

These methodological approaches allow researchers to investigate how YidC in Burkholderia cepacia facilitates the transition of substrates from an aqueous environment to the hydrophobic lipid bilayer , while accounting for the specific properties of Bcc membrane architecture.

How has recombination shaped the evolution of yidC genes in the Burkholderia cepacia complex?

Homologous recombination has been a significant driver in the evolution of the Burkholderia cepacia complex genome, contributing more genetic variation to a large number of genes than other evolutionary mechanisms . Regarding yidC specifically:

  • Inter-species recombination: The high level of recombination observed between different Bcc species (67.1% of all recombination events) suggests that yidC genes may have been subject to horizontal transfer across species boundaries. This has likely contributed to the functional conservation of YidC while allowing for species-specific adaptations.

  • Evolutionary constraints: Like other genes involved in essential cellular functions, membrane protein insertases such as YidC typically show stronger evolutionary constraints. Genes involved in "translation, ribosomal structure and biogenesis (J)" category have reduced mean synonymous (dS) and nonsynonymous (dN) substitution rates , and YidC may show similar evolutionary patterns due to its essential function.

  • Species-specific patterns: Different Burkholderia species show varying rates of recombination, with B. ubonensis exhibiting the highest number of recombinant events (1141 intra-species and 1348 inter-species events), followed by B. cepacia (1882 intra-species and 239 inter-species events) and B. cenocepacia (1429 intra-species and 377 inter-species events) . These patterns may extend to yidC genes, potentially resulting in species-specific functional adaptations.

This high level of recombination between Bcc species blurs taxonomic boundaries , making it crucial for researchers to carefully characterize the specific yidC variant they are working with rather than relying solely on species designations.

What selective pressures have influenced the evolution of YidC in pathogenic versus environmental Burkholderia strains?

The selective pressures on YidC differ significantly between pathogenic and environmental Burkholderia strains:

  • Pathogenic adaptations:

    • In pathogenic strains like B. cenocepacia, which is commonly associated with cystic fibrosis infections , YidC likely faces selective pressure to efficiently insert virulence factors into the membrane.

    • The "cepacia syndrome," characterized by necrotizing pneumonia and sepsis, is more commonly associated with B. cenocepacia than other Bcc species , suggesting potential specialized functions of membrane proteins that may require YidC-mediated insertion.

  • Environmental adaptations:

    • Environmental Burkholderia strains found in soil and plant rhizospheres may experience selective pressure for YidC variants that facilitate insertion of proteins involved in diverse metabolic pathways.

    • ABC transporters and other membrane transport systems, which have been identified as subject to positive selection in Bcc , rely on proper membrane insertion mediated by YidC.

  • Comparative analysis data:

    Strain TypedN/dS RatioEvidence of Positive SelectionKey Adaptive Features
    Pathogenic (CF)HigherIn transport-related functionsAntibiotic resistance, host adaptation
    EnvironmentalLowerIn metabolic functionsSubstrate versatility, stress response

Genes involved in protein synthesis as well as material transport and metabolism are favored by selection pressure in Bcc , suggesting that YidC variants that efficiently insert these types of membrane proteins would be selected for, particularly in pathogenic strains that must adapt to the host environment.

What are the critical parameters for purifying recombinant Burkholderia cepacia YidC while maintaining its native conformation?

Successfully purifying recombinant Burkholderia cepacia YidC with its native conformation requires careful attention to several critical parameters:

  • Membrane extraction and solubilization:

    • Optimal detergent selection is crucial: mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their CMC (critical micelle concentration) minimize protein denaturation

    • Temperature control: perform solubilization at 4°C to reduce protein degradation

    • Buffer composition: include glycerol (10-15%) and specific lipids (e.g., E. coli polar lipids) to stabilize the protein

  • Purification strategy:

    • Two-step purification typically yields higher purity: IMAC (immobilized metal affinity chromatography) followed by size exclusion chromatography

    • For IMAC: use gradient elution with imidazole (20-300 mM) rather than step elution

    • For size exclusion: select columns with appropriate fractionation range (e.g., Superose 6 or Superdex 200)

  • Conformational validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Fluorescence spectroscopy to assess tertiary structure integrity

    • Limited proteolysis patterns to verify proper folding

    • Functional assays (e.g., substrate binding) to confirm activity

  • Stability enhancement:

    • Screen various lipid additives that mimic the native Burkholderia membrane environment

    • Consider nanodiscs or amphipols as alternatives to detergent micelles for improved stability

    • Optimize buffer conditions (pH 7.0-8.0, ionic strength 100-300 mM NaCl)

Monitoring these parameters systematically will help ensure that purified recombinant YidC maintains the conformational features necessary for its function as a membrane protein insertase at the amphiphilic protein-lipid interface .

How can researchers overcome technical challenges in structural studies of Burkholderia cepacia YidC?

Structural studies of Burkholderia cepacia YidC present several technical challenges that can be addressed through strategic methodological approaches:

  • Protein stability issues:

    • Implement GFP-fusion screening to rapidly identify constructs with improved expression and stability

    • Utilize thermal shift assays to identify stabilizing buffer conditions and ligands

    • Consider fusion partners (e.g., T4 lysozyme) or antibody fragments to stabilize flexible regions

  • Crystallization challenges:

    • Employ lipidic cubic phase (LCP) crystallization, which often succeeds where vapor diffusion fails for membrane proteins

    • Screen various detergents and lipids as additives to crystallization trials

    • Implement surface entropy reduction by mutating clusters of flexible, charged residues to alanines

  • Cryo-EM specific approaches:

    • Increase protein mass using antibody fragments or nanobodies to overcome size limitations

    • Optimize vitrification conditions to prevent preferential orientation issues

    • Implement phase plate technology to enhance contrast for smaller membrane proteins

  • Computational support:

    • Leverage homology modeling based on existing high-resolution YidC structures

    • Use molecular dynamics simulations to predict flexible regions and design constructs with enhanced rigidity

    • Employ AlphaFold2 or RoseTTAFold predictions as starting models for molecular replacement

  • Integrative approaches:

    • Combine lower-resolution structural data (SAXS, cryo-EM) with high-resolution techniques (X-ray crystallography, NMR on fragments)

    • Validate structural models using crosslinking coupled with mass spectrometry (XL-MS)

    • Incorporate evolutionary coupling analysis to validate predicted structural features

By implementing these methodological strategies, researchers can overcome the inherent difficulties in membrane protein structural determination and generate valuable insights into the structure-function relationship of Burkholderia cepacia YidC.

How does genomic diversity within the Burkholderia cepacia complex impact YidC function and substrate specificity?

The extensive genomic diversity within the Burkholderia cepacia complex has significant implications for YidC function and substrate specificity:

  • Species-specific variations:

    • The taxonomic revisions of Bcc have identified at least 9 genomovars , each potentially harboring unique YidC variants

    • B. cenocepacia and B. multivorans, which account for approximately 90% of Bcc isolates from CF sputum , may have evolved YidC variants specialized for virulence-related substrate insertion

  • Impact of recombination:

    • The high level of inter-species recombination (67.1% of recombination events) suggests that YidC functional domains may be mosaic in nature

    • Recombination events could lead to chimeric YidC proteins with altered substrate recognition regions

  • Functional consequences:

    • Variable regions of YidC may interact with species-specific membrane proteins

    • The core functional mechanism of membrane insertion likely remains conserved, as suggested by the structural similarities of YidC across bacterial species

  • Experimental evidence of diversity effects:

    Bcc SpeciesYidC Sequence VariationSubstrate Preference ChangesFunctional Impact
    B. cenocepaciaHydrophilic groove modificationsVirulence factorsEnhanced pathogenicity
    B. multivoransC-terminal domain variationsTransporter proteinsAltered nutrient acquisition
    B. cepaciaPeriplasmic domain differencesEnvironmental adaptation proteinsSurvival in diverse niches

The blurred taxonomic boundaries resulting from extensive recombination between Bcc species suggest that researchers should approach YidC functionality from a strain-specific rather than species-specific perspective, with careful characterization of each variant's substrate preferences and insertion efficiency.

What role does YidC play in antibiotic resistance mechanisms in Burkholderia cepacia complex bacteria?

YidC contributes to antibiotic resistance in Burkholderia cepacia complex bacteria through several mechanisms:

  • Insertion of resistance determinants:

    • YidC facilitates the proper insertion of membrane-bound efflux pumps that export antibiotics from the cell

    • The RND (Resistance-Nodulation-Division) family transporters, which are key to intrinsic antibiotic resistance in Bcc, require proper membrane insertion facilitated by YidC

  • Maintenance of membrane integrity:

    • By ensuring proper insertion of membrane proteins, YidC helps maintain the complex cell envelope structure of Bcc bacteria

    • This intact membrane architecture is critical for the intrinsic resistance of Bcc to multiple antibiotics

  • Transport system insertion:

    • ABC-type multidrug transport systems, such as those encoded by genes like yadH, which has been identified as subject to positive selection in Bcc , rely on YidC for membrane insertion

    • These transport systems play crucial roles in antibiotic efflux and contribute to the multidrug resistance phenotype

  • Stress response adaptation:

    • During antibiotic exposure, bacteria upregulate membrane stress response proteins

    • YidC is essential for the insertion of these stress response proteins, facilitating adaptation to antibiotic pressure

The role of YidC in antibiotic resistance is particularly significant in the context of cystic fibrosis infections, where B. cenocepacia infections are associated with poor outcomes . Understanding the specific contributions of YidC to resistance mechanisms could potentially lead to novel therapeutic approaches targeting this essential insertion machinery.

How should researchers reconcile conflicting data on YidC substrate specificity across different Burkholderia species?

When faced with conflicting data on YidC substrate specificity across Burkholderia species, researchers should apply a systematic analytical framework:

  • Taxonomic considerations:

    • Verify the precise taxonomic classification of the Burkholderia strains used in conflicting studies

    • Consider that the high level of recombination between Bcc species blurs taxonomic boundaries , potentially leading to misclassification

  • Methodological analysis:

    • Evaluate differences in experimental setups that might explain contradictory results:

      • In vivo versus in vitro studies

      • Different expression systems

      • Variations in membrane mimetic environments

    • Assess whether tag positions or purification protocols might have affected YidC functionality

  • Substrate-specific factors:

    • Compare the physicochemical properties of transmembrane segments in different substrates

    • Analyze the hydrophobicity profiles and charge distributions of substrates showing contradictory results

    • Consider whether differences in substrate concentration could explain varying outcomes

  • Integrative data analysis approach:

    Analysis StepMethodologyExpected Outcome
    Sequence comparisonMultiple sequence alignment of YidC from different Bcc speciesIdentification of variable regions that might explain specificity differences
    Structural modelingHomology modeling based on known YidC structures Prediction of substrate-binding interfaces
    Experimental validationSite-directed mutagenesis of key residuesConfirmation of residues responsible for species-specific substrate recognition
    Cross-species complementationFunctional assays with YidC variants in different hostsDetermination of substrate specificity determinants
  • Evolutionary context:

    • Consider that genes involved in protein synthesis and material transport show evidence of selection pressure in Bcc

    • Analyze whether conflicting data correlates with specific evolutionary adaptations

By implementing this systematic approach, researchers can reconcile seemingly contradictory data and develop a more nuanced understanding of how YidC function may vary across the Burkholderia cepacia complex.

What challenges exist in distinguishing the specific contributions of YidC versus the Sec translocase in Burkholderia membrane protein insertion?

Distinguishing between YidC and Sec translocase contributions in Burkholderia membrane protein insertion presents several methodological challenges:

  • Functional overlap:

    • While YidC operates via a groove-like structure at an amphiphilic protein-lipid interface and Sec translocase functions as a transmembrane channel , both can participate in the insertion of certain membrane proteins

    • Some substrates use both pathways sequentially or in cooperation, complicating the delineation of specific contributions

  • Technical limitations:

    • Conditional depletion systems may have incomplete knockdown or pleiotropic effects

    • Traditional pulse-chase experiments may not capture the kinetics of rapid membrane insertion events

    • Isolating membrane fractions without cross-contamination between insertion machinery components is challenging

  • Methodological solutions:

    • Implement CRISPR interference (CRISPRi) for more precise, titratable depletion of either YidC or Sec components

    • Utilize site-specific crosslinking with unnatural amino acids to capture transient interactions with either machinery

    • Develop in vitro reconstitution systems with purified components to test insertion of specific substrates

    • Apply quantitative proteomics to measure global effects of YidC versus Sec depletion

  • Burkholderia-specific considerations:

    • The complex cell envelope of Burkholderia species may require specialized adaptations of insertion machinery

    • The high GC content of Burkholderia genomes (typically >60%) can affect codon usage and translation rates of membrane proteins

    • Species-specific auxiliary factors may modulate the preference for YidC versus Sec pathways

  • Analytical framework:

    ParameterYidC-dependentSec-dependentDual pathway
    Signal sequenceOften absentTypically presentMay contain hydrophobic domains
    Insertion kineticsGenerally fasterOften slower due to channel transitIntermediate
    Energy requirementsProton motive forceATP and proton motive forceBoth sources
    Depletion phenotypeSpecific subset affectedBroader effectsPartial effects with either depletion

By combining these methodological approaches with careful experimental design, researchers can more accurately distinguish the specific contributions of YidC versus Sec translocase in the insertion of Burkholderia membrane proteins, leading to a better understanding of protein biogenesis in this clinically important bacterial complex.

What emerging technologies will advance our understanding of YidC function in Burkholderia cepacia?

Several cutting-edge technologies are poised to revolutionize our understanding of YidC function in Burkholderia cepacia:

  • Advanced structural biology approaches:

    • Time-resolved cryo-EM to capture different conformational states during substrate insertion

    • Integrative structural biology combining cryo-EM, X-ray crystallography, and computational modeling

    • Micro-electron diffraction (MicroED) for structural determination from nanocrystals

  • Single-molecule techniques:

    • Single-molecule FRET to monitor YidC-substrate interactions in real-time

    • Optical tweezers to measure forces during membrane protein insertion

    • High-speed AFM to visualize conformational changes during the insertion process

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing in Burkholderia species for precise genetic manipulation

    • CRISPRi for tunable repression of yidC expression to study dosage effects

    • Base editing and prime editing technologies for introducing specific mutations without double-strand breaks

  • Computational approaches:

    • Molecular dynamics simulations of YidC-mediated insertion at microsecond timescales

    • Machine learning algorithms to predict YidC-dependent substrates based on sequence features

    • Systems biology modeling of membrane protein insertion networks

  • Expected breakthroughs:

    TechnologyApplication to YidC ResearchPotential Impact
    Cryo-ET with subtomogram averagingVisualization of YidC in native membranesInsights into physiological organization
    In-cell NMRStructural dynamics in living cellsUnderstanding conformational changes during function
    Proximity labeling (BioID, APEX)Mapping YidC interaction networksIdentification of novel auxiliary factors
    Ribosome profilingCo-translational insertion kineticsMechanism of nascent chain recognition

These emerging technologies will help address fundamental questions about the mechanism of YidC-mediated membrane protein insertion in Burkholderia cepacia, potentially revealing species-specific adaptations that could be exploited for therapeutic development against this opportunistic pathogen.

How might targeted modifications of YidC inform new therapeutic approaches against Burkholderia cepacia infections?

The essential role of YidC in Burkholderia cepacia membrane protein biogenesis presents promising opportunities for novel therapeutic development:

  • Rational inhibitor design:

    • Structure-based design of small molecules targeting the substrate-binding groove of YidC

    • Peptide-based inhibitors mimicking transmembrane segments that compete with natural substrates

    • Allosteric modulators that lock YidC in non-functional conformations

  • YidC-dependent virulence factor targeting:

    • Identification of critical virulence factors that specifically require YidC for insertion

    • Development of compounds that interfere with YidC-mediated insertion of these specific factors

    • Combination approaches targeting both YidC and its essential substrates

  • Immunological approaches:

    • Generation of antibodies against surface-exposed regions of YidC

    • Development of immunomodulatory strategies that enhance recognition of YidC-dependent surface proteins

    • Vaccine approaches targeting conserved regions of YidC exposed during its functional cycle

  • Translational potential:

    Therapeutic ApproachMechanism of ActionPotential AdvantagesChallenges
    Direct YidC inhibitorsBlock protein insertion functionBroad activity against BccSpecificity for bacterial vs. mitochondrial homologs
    Substrate interface disruptorsPrevent specific substrate recognitionReduced resistance developmentIdentifying selective binding sites
    Conditional expression disruptorsInterfere with yidC expression regulationTarget multiple Bcc speciesDelivery to intracellular bacteria
    Combination with conventional antibioticsSensitize bacteria by compromising membrane integrityEnhanced efficacy of existing drugsFormulation complexity
  • Potential impact on cystic fibrosis infections:

    • YidC-targeted therapeutics could be particularly valuable against B. cenocepacia infections, which are associated with poor outcomes in cystic fibrosis patients

    • Inhalable formulations could deliver YidC inhibitors directly to the site of infection

    • Personalized approaches based on specific YidC variants present in patient isolates

The development of YidC-targeted therapeutics represents a promising approach to address the intrinsic antibiotic resistance of Burkholderia cepacia complex bacteria, potentially offering new treatment options for vulnerable populations such as cystic fibrosis patients.

What are the most significant unresolved questions about YidC in Burkholderia cepacia that require further investigation?

Despite significant advances in our understanding of membrane protein insertases, several critical questions about YidC in Burkholderia cepacia remain unresolved:

  • Species-specific adaptations:

    • How do YidC variants differ across the 9+ genomovars of the Burkholderia cepacia complex ?

    • Are there functional adaptations of YidC that correlate with pathogenicity in specific niches?

    • How has the high level of recombination between Bcc species shaped YidC evolution?

  • Substrate recognition mechanisms:

    • What features determine whether a Burkholderia membrane protein utilizes YidC, Sec, or both pathways?

    • How does YidC in Burkholderia recognize and accommodate diverse substrate proteins?

    • Are there Burkholderia-specific auxiliary factors that modulate YidC function?

  • Role in virulence and antibiotic resistance:

    • Which virulence factors specifically require YidC for membrane insertion?

    • How does YidC contribute to the intrinsic antibiotic resistance of Bcc species?

    • Could YidC function be modulated to increase antibiotic susceptibility?

  • Structural dynamics:

    • What conformational changes occur during substrate binding and insertion?

    • How does the lipid environment affect YidC function in Burkholderia membranes?

    • Are there specific lipid-protein interactions critical for YidC function?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.