Recombinant Burkholderia cepacia NADH-quinone oxidoreductase subunit A (nuoA)

What is Burkholderia cepacia NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in bacterial metabolism?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of the respiratory chain complex I in Burkholderia cepacia. This protein functions as part of the NADH dehydrogenase I complex (EC 1.6.99.5), which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . The nuoA subunit is specifically involved in the membrane-embedded arm of the complex and contributes to proton translocation across the bacterial membrane. In B. cepacia, this enzyme plays a critical role in energy production and bacterial survival, particularly in oxygen-limited environments where respiratory flexibility becomes essential for pathogen persistence .

The amino acid sequence of nuoA (MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE) reveals its highly hydrophobic nature, consistent with its role as a membrane-spanning protein . This characteristic is important when designing experiments to purify and study the protein, as special solubilization techniques are required.

How does Burkholderia cepacia's nuoA differ from homologous proteins in other bacterial species?

Burkholderia cepacia nuoA shows notable structural and functional differences from homologous proteins in other bacterial species. While the core catalytic function is conserved, B. cepacia nuoA exhibits specific adaptations that may contribute to the organism's metabolic versatility and pathogenicity .

Sequence analysis reveals that nuoA from B. cepacia (strain J2315/LMG 16656) contains unique regions that distinguish it from other bacterial species, particularly in the transmembrane segments . These differences may contribute to the remarkable adaptability of B. cepacia in diverse environments, from soil to the human respiratory tract, and its ability to cause opportunistic infections, especially in immunocompromised patients .

The protein belongs to the Burkholderia cepacia complex (BCC), which includes at least 17 distinct species with varying degrees of pathogenicity . This diversity within the BCC affects the structure and function of nuoA and other bacterial proteins, potentially contributing to differences in antibiotic resistance and virulence.

What are the optimal conditions for expressing recombinant Burkholderia cepacia nuoA protein?

Expressing recombinant nuoA from B. cepacia requires careful optimization due to its membrane-associated nature. Based on established protocols for similar proteins, the following conditions typically yield optimal expression:

Expression System Selection:

• E. coli BL21(DE3) strains are commonly used for membrane protein expression

• C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression may improve yields

• Consider codon optimization for the target sequence, especially since the expression region spans amino acids 1-119

Expression Parameters:

• Induction at OD600 = 0.6-0.8 with 0.1-0.5 mM IPTG

• Lower temperatures (16-20°C) for induction to reduce inclusion body formation

• Extended expression time (16-24 hours) at reduced temperatures

Purification Considerations:

• Solubilization using detergents compatible with membrane proteins (e.g., DDM, LDAO)

• Affinity purification using appropriate tags determined during the production process

• Storage in Tris-based buffer with 50% glycerol to maintain stability

When working with this protein, it's crucial to follow proper storage guidelines: store at -20°C for short-term and -20°C or -80°C for extended storage. Repeated freezing and thawing should be avoided, and working aliquots should be stored at 4°C for a maximum of one week .

What experimental approaches can be used to study nuoA function in Burkholderia cepacia?

Several experimental approaches can elucidate nuoA function in B. cepacia:

• Genetic approaches:

  • Gene knockout or knockdown studies to assess the impact on bacterial growth and metabolism

  • Complementation assays to confirm phenotypic changes are due to nuoA manipulation

  • Site-directed mutagenesis to identify critical residues for function

• Biochemical approaches:

  • Enzyme activity assays measuring NADH oxidation and quinone reduction

  • Membrane potential measurements to assess proton translocation

  • Protein-protein interaction studies to map interactions with other complex I subunits

• Structural biology approaches:

  • Cryo-electron microscopy for whole complex structure determination

  • NMR spectroscopy for dynamic studies of membrane-embedded regions

  • X-ray crystallography for high-resolution structural information

• Systems biology approaches:

  • Transcriptomics to identify gene expression changes in response to nuoA modulation

  • Metabolomics to assess global metabolic shifts

  • Flux analysis to quantify changes in electron transport chain efficiency

These methods should be implemented using optimal experimental design (OED) principles to maximize information gain while minimizing resources. The Bayesian and decision-theoretic approaches are particularly suitable for these complex biological systems with potential nonlinearities .

How can optimal experimental design enhance research on Burkholderia cepacia nuoA protein function?

Optimal experimental design (OED) provides a formal framework to maximize information gain when studying complex proteins like B. cepacia nuoA. For researchers investigating this protein, OED offers several advantages:

• Parameter Estimation Optimization:

  • Design experiments to precisely estimate kinetic parameters of nuoA enzymatic activity

  • Identify optimal sampling time points for time-course experiments

  • Determine optimal substrate concentrations for Michaelis-Menten kinetics studies

• Model Discrimination:

  • Design experiments that can distinguish between competing hypotheses about nuoA function

  • Select experimental conditions that maximize the expected difference in predictions from alternative models

  • Formalize Bayesian updating of beliefs about model structures as new data is collected

• Sequential Design Strategies:

  • Implement adaptive experimental protocols that update based on information gained from previous experiments

  • Build non-myopic design policies that coordinate across multiple experiments

  • Navigate the exploration-exploitation tradeoff when studying nuoA under different conditions

When implementing OED for nuoA research, computational challenges may arise due to the complexity of the biological system. Methods to address these challenges include approximate Bayesian computation, surrogate modeling, and efficient sampling techniques that are particularly useful for the high-dimensional parameter spaces often encountered in studies of respiratory chain components .

What role does nuoA play in Burkholderia cepacia pathogenicity, particularly in non-cystic fibrosis infections?

While B. cepacia is well-known for infections in cystic fibrosis patients, its pathogenicity in non-CF patients, particularly related to nuoA function, presents an important research area:

• Metabolic Adaptation During Infection:

  • nuoA-dependent respiratory adaptations contribute to B. cepacia survival in oxygen-limited infection sites

  • The protein may enable metabolic flexibility in diverse host environments, from bloodstream to tissue niches

  • Energy production through nuoA-containing complex I likely supports bacterial persistence during chronic infection

• Virulence Factor Regulation:

  • Energy metabolism through nuoA activity potentially regulates expression of virulence factors

  • Respiratory chain components contribute to stress resistance in hostile host environments

  • nuoA function may influence biofilm formation, a key virulence determinant in B. cepacia infections

• Clinical Implications:

  • B. cepacia can cause severe infections in immunocompromised patients, with mortality rates from bloodstream infections reaching 25-64%

  • Nosocomial infections primarily occur in ICU patients, suggesting nuoA may play a role in hospital-acquired bacterial adaptation

  • Increasing antimicrobial resistance necessitates new targets, potentially including respiratory chain components like nuoA

Research methodologies exploring these connections should employ both in vitro systems and appropriate animal models that recapitulate the specific physiological conditions of non-CF infections to accurately assess nuoA's contribution to pathogenicity.

How can structural studies of nuoA inform drug development targeting Burkholderia cepacia respiratory chain?

Structural studies of nuoA provide valuable insights for antimicrobial development:

• Structure-Based Drug Design:

  • High-resolution structures can identify druggable pockets unique to bacterial nuoA

  • Comparative analysis with human mitochondrial complex I homologs can identify bacterial-specific features

  • In silico docking and molecular dynamics simulations can predict potential inhibitor binding and efficacy

• Protein-Protein Interaction Interfaces:

  • Mapping interaction surfaces between nuoA and other complex I subunits reveals potential points for disruption

  • Peptide mimetics targeting these interfaces could specifically inhibit bacterial complex assembly

  • Small molecules that destabilize these interactions represent novel antimicrobial strategies

• Functional Domains Analysis:

  • Identifying essential functional domains within the 119-amino acid expression region provides targeted inhibition sites

  • The highly hydrophobic transmembrane regions present opportunities for developing membrane-penetrating inhibitors

  • Conserved motifs involved in proton translocation offer targets for function-specific inhibition

Given the challenges of antimicrobial resistance in B. cepacia infections and the limited treatment options (currently including ceftazidime, meropenem, and trimethoprim-sulfamethoxazole) , targeting nuoA could provide an alternative therapeutic approach, especially for multi-drug resistant strains commonly encountered in clinical settings.

What methodological approaches can overcome challenges in assessing nuoA function within the intact respiratory chain complex?

Studying nuoA within the intact respiratory complex presents several technical challenges:

• Complex Reconstruction and Analysis:

  • Nanoscale reconstitution systems using proteoliposomes or nanodiscs to study nuoA in near-native environments

  • Activity coupling assays that measure sequential electron transfer through the respiratory chain

  • Time-resolved spectroscopy to capture transient interactions during electron transfer events

• Live-Cell Imaging Approaches:

  • FRET-based sensors to monitor protein-protein interactions in living bacterial cells

  • Super-resolution microscopy to visualize complex organization and dynamics

  • Correlative light and electron microscopy to link function with structure in intact bacterial membranes

• Real-Time Activity Measurements:

  • Microfluidic systems for real-time monitoring of respiratory chain activity

  • Electrode-based techniques to measure electron transfer kinetics

  • Hydrogen/deuterium exchange mass spectrometry to detect conformational changes during activity

These advanced methodological approaches should incorporate Bayesian experimental design principles to address the inherent complexity and variability in these systems. Sequential experimental design approaches that adapt based on outcomes from previous experiments are particularly valuable for studying dynamic systems like the respiratory chain .

Comparative Sequence Analysis of nuoA Across Burkholderia Species

This table presents estimated values based on typical patterns of conservation across the Burkholderia cepacia complex (BCC), which includes at least 17 distinct species with varying degrees of genetic similarity .

Experimental Conditions for Functional Analysis of Recombinant nuoA

These experimental conditions should be optimized using principles of optimal experimental design, particularly for complex biological systems with potential nonlinearities and high parameter dimensions .