Recombinant Burkholderia cepacia NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Burkholderia cepacia NADH-quinone oxidoreductase subunit K (nuoK) is a component of the respiratory chain Complex I (NADH:ubiquinone oxidoreductase). It facilitates electron transfer from NADH to ubiquinone, contributing to proton gradient generation and ATP synthesis . The recombinant form is produced in Escherichia coli with an N-terminal His tag for purification .

Key Functions:

  • Catalyzes NADH oxidation (EC 1.6.99.5) .

  • Participates in redox homeostasis and oxidative phosphorylation .

Production and Purification

Expression System:

  • Host: E. coli .

  • Tag: N-terminal His tag for affinity chromatography .

Mutational Studies:

  • Deletion of nuo (Complex I) in Pseudomonas taiwanensis led to compensatory upregulation of alternative NADH dehydrogenases (e.g., ndh-2), preserving redox balance .

  • Double deletions (e.g., nuo + ndh-2) were lethal, underscoring the essentiality of NADH oxidation pathways .

Applications and Research Use

Research Implications:

  • Pathogenicity Studies: Bcc species cause opportunistic infections in immunocompromised hosts; understanding nuoK could inform therapeutic strategies .

  • Metabolic Engineering: Insights into NADH dehydrogenase flexibility aid in optimizing microbial respiration for bioproduction .

Comparative Genomic Context

Burkholderia cepacia complex comprises 20+ species, including B. cenocepacia and B. multivorans, with shared core genes like nuoK . Orthologs of nuoK exist in 427 bacterial genera, highlighting its conserved role in respiration .

Challenges and Future Directions

  • Structural Studies: No resolved 3D structure exists for B. cepacia nuoK, though AlphaFold predictions are available .

  • Clinical Relevance: Further work is needed to link nuoK variants to virulence or antibiotic resistance in Bcc pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments include standard blue ice packs. Should you require dry ice packaging, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots may be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference point for your convenience.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; BceJ2315_22940; BCAL2334; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315))
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAIAIVGIFLNRRNVIIILMSIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane. Consequently, the redox energy is conserved as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of nuoK in Burkholderia cepacia?

NuoK functions as a critical component of the 'antiporter module' within respiratory chain Complex I in Burkholderia cepacia. This protein participates in the oxidation of NADH in the bacterial cytoplasm and reduction of quinone in the membrane, coupled to proton pumping across the membrane (4H⁺/2e⁻). Research has established that NuoK is homologous to MrpC protein, suggesting evolutionary relationships between different proton-pumping systems . The significance of nuoK extends beyond basic metabolism, as the respiratory chain functionality may contribute to B. cepacia's persistence in cystic fibrosis patients' lungs and potential pathogenicity in up to one-third of infected individuals .

How is Burkholderia cepacia taxonomically classified?

Burkholderia cepacia belongs to a complex (Bcc) comprising almost 20 different species. The most common species found in cystic fibrosis patients include B. cepacia, B. cenocepacia, B. multivorans, B. vietnamiensis, and B. dolosa . Taxonomic identification of Burkholderia species has evolved significantly since the genus was separated from Pseudomonas in the 1990s . While 16S rRNA and 23S rRNA gene sequencing are commonly used for bacterial identification, these methods can efficiently identify the Burkholderia genus but cannot reliably distinguish between species within the complex . For precise species-level identification, more advanced molecular techniques like Multilocus Sequence Typing/Analysis (MLST/MLSA) are needed, though even this approach has limitations due to the substantial genetic variation among Burkholderia species .

What methodological approaches are used to identify Burkholderia cepacia complex species?

Several methodological approaches have been developed for identifying Burkholderia cepacia complex species:

MethodDescriptionAccuracyLimitations
16S rRNA gene sequencingBasic molecular identificationHigh at genus levelLimited resolution for species identification
SMART protocol with multiplex PCRModified selective isolation strategy95% at bacterial levelRequires secondary confirmation
rpsU sequencingGenus level identificationHigh at genus levelRequires additional procedures for species-level identification
MALDI-TOF mass spectrometryProtein-based identificationNo false results at genus levelMay not identify specific species absent from reference library
LC–MS/MS MRM assayGene-protein based approach using 16 different peptidesHigh sensitivityRequires manual curation of phylogenetic partitions

Modern approaches increasingly use multiple techniques in combination for accurate identification. The MALDI Biotyper tool and Liquid Chromatography-Mass Spectrometry Multiple Reaction Monitoring (LC–MS/MS MRM) assays have demonstrated particular promise for Burkholderia identification .

How should experimental designs be structured when studying nuoK function in Burkholderia cepacia?

When designing experiments to study nuoK function in B. cepacia, researchers should employ robust experimental designs that establish causality. The classic experimental approach utilizing random assignment (R) of subjects to experimental and control groups is recommended . The experimental notation should be clearly defined, with observations denoted as "O" and treatment as "X" .

For nuoK functional studies, consider implementing the Solomon 4-Group Design to address the potential effect of pretesting on outcomes. This design incorporates four groups (two experimental, two control), with one experimental group and one control group receiving both pretest and posttest, while the remaining groups only receive posttests . This approach is particularly valuable when measuring phenotypic changes resulting from nuoK modification, as it controls for testing effects that might confound results.

What gene deletion strategies are effective for studying nuoK function in Burkholderia species?

For genetic manipulation of nuoK in Burkholderia species, the allelic exchange mutagenesis system utilizing SceI endonuclease has proven effective. This two-plasmid system employs:

  • A suicide plasmid containing the desired mutation flanked by sequences homologous to the target gene

  • A second plasmid (pDAI-SceI-SacB) carrying the I-SceI endonuclease encoding gene

The methodology proceeds as follows:

  • The suicide plasmid is introduced into B. cenocepacia by triparental mating

  • Cointegrants are selected using trimethoprim and chloramphenicol

  • The pDAI-SceI-SacB plasmid is mobilized into cointegrants

  • I-SceI produces a genomic strand break

  • Homologous recombination allows bacteria to repair the break, with a 50% chance of resulting in gene deletion

Resolution of merodiploids is achieved by excision of the integrated plasmid, with counterselection based on tetracycline resistance and trimethoprim/chloramphenicol sensitivity . This approach enables precise genetic modifications to study nuoK function while minimizing polar effects on adjacent genes.

How does the membrane localization of nuoK affect experimental approaches?

The membrane localization of nuoK presents unique challenges for experimental studies. As part of the antiporter module of respiratory chain Complex I, nuoK is embedded in the bacterial membrane, participating in proton pumping (4H⁺/2e⁻) across the membrane coupled to NADH oxidation and quinone reduction .

When designing experiments involving membrane proteins like nuoK, researchers should consider:

  • Protein extraction protocols that effectively solubilize membrane proteins while maintaining their structure

  • Detergent selection appropriate for nuoK stability and function

  • Expression systems that properly integrate the protein into membrane structures

  • Protein tagging strategies that don't disrupt membrane insertion or function

For recombinant expression, E. coli-based systems require careful optimization of membrane protein expression conditions, including induction temperature, inducer concentration, and host strain selection. Alternative expression systems like Pichia pastoris may be considered for improved membrane protein folding and insertion. Functional assays should measure proton pumping activity to confirm proper membrane integration and function of recombinant nuoK.

How should researchers address data that contradicts hypotheses about nuoK function?

When data contradicts initial hypotheses about nuoK function, researchers should implement a structured approach to investigate the discrepancy:

  • Thoroughly examine the data to identify specific patterns that contradict the hypothesis, paying particular attention to outliers that may influence results .

  • Compare findings with existing literature on nuoK and related proteins (such as MrpC) to contextualize the unexpected results .

  • Evaluate initial assumptions about nuoK function, considering alternative roles beyond the established antiporter module function .

  • Assess the experimental design for potential confounding variables, particularly when working with complex bacterial systems like B. cepacia .

  • Consider species-specific variations within the Burkholderia cepacia complex that might influence nuoK function or expression .

When unexpected data emerges, it's crucial to maintain an open mind, as contradictory findings often lead to new discoveries. For example, the homology between NuoK and MrpC was initially an unexpected finding that revealed evolutionary relationships between different proton-pumping systems . Such contradictions might similarly reveal new aspects of nuoK function or regulation in B. cepacia.

What considerations are important when interpreting nuoK expression data in different Burkholderia cepacia complex species?

When interpreting nuoK expression data across different Burkholderia cepacia complex species, researchers must account for several factors:

  • Species-specific variations: The Burkholderia cepacia complex includes almost 20 different species with genetic variations that may affect nuoK expression patterns .

  • Taxonomic accuracy: Ensure precise identification of the bacterial species being studied, as 16S rRNA sequencing alone cannot reliably distinguish between Bcc species .

  • Environmental conditions: B. cepacia species inhabit diverse environments, from soil to CF patients' lungs, which may influence nuoK expression .

  • Pathogenicity differences: Some Bcc species (e.g., B. cenocepacia and B. dolosa) demonstrate higher pathogenicity, potentially correlating with differential regulation of respiratory components like nuoK .

  • Evolutionary context: Consider the homology between nuoK and related proteins (like MrpC) when interpreting expression patterns across species .

A comparative analysis approach is recommended, utilizing standardized growth conditions and molecular techniques across multiple well-characterized Bcc strains. This enables identification of species-specific nuoK expression patterns that may correlate with functional differences or pathogenicity.

What methodological challenges exist in studying recombinant nuoK from pathogenic Burkholderia cepacia strains?

Studying recombinant nuoK from pathogenic Burkholderia cepacia strains presents several methodological challenges:

  • Biosafety considerations: B. cepacia poses infection risks, particularly for immunocompromised individuals and CF patients, requiring appropriate biosafety measures .

  • Genetic manipulation difficulties: The genetic diversity within the Bcc complicates the development of universal genetic tools and protocols .

  • Expression system selection: Heterologous expression of membrane proteins like nuoK requires careful optimization of expression conditions and host selection.

  • Functional validation: Confirming proper folding and function of recombinant nuoK requires specialized assays for measuring proton pumping activity.

  • Cross-contamination risks: When working with multiple Burkholderia strains, cross-contamination prevention is essential for reliable results .

Researchers can address these challenges by implementing appropriate biosafety protocols, using validated species identification methods, optimizing expression systems specifically for membrane proteins, and employing functional assays that directly measure nuoK activity rather than just expression levels.

How does nuoK function compare between Burkholderia cepacia and other respiratory pathogens?

The nuoK subunit's function in B. cepacia can be compared with its counterparts in other respiratory pathogens:

OrganismnuoK FunctionUnique FeaturesClinical Relevance
Burkholderia cepaciaComponent of antiporter module in Complex IHomologous to MrpCPotential role in CF lung infection persistence
Pseudomonas aeruginosaSimilar proton-pumping functionDifferent evolutionary lineageMajor CF pathogen
Mycobacterium tuberculosisAlternative NADH dehydrogenasesDifferent respiratory chain organizationPrimary respiratory pathogen
Staphylococcus aureusLacks Complex IUses alternative respiratory pathwaysCommon respiratory pathogen

The nuoK subunit in B. cepacia, as part of the antiporter module of respiratory chain Complex I, participates in proton pumping coupled to NADH oxidation . This function is critical for energy production and potentially contributes to the bacterium's persistence in hostile environments such as CF patients' lungs . The homology between nuoK and MrpC suggests evolutionary relationships between different proton-pumping systems, which may represent adaptations to specific environmental niches .

Understanding the comparative function of nuoK across respiratory pathogens may provide insights into potential therapeutic targets or evolutionary adaptations that contribute to pathogenicity in respiratory infections.

What is the relationship between nuoK function and Burkholderia cepacia pathogenicity in cystic fibrosis patients?

The relationship between nuoK function and B. cepacia pathogenicity in CF patients appears complex. In CF patients, B. cepacia infection can have variable outcomes - in many cases, the infection may not worsen lung disease, but in up to one-third of infected individuals, it can cause rapid decline in lung function and health, potentially leading to severe lung disease and death .

While no direct evidence in the provided search results specifically links nuoK function to pathogenicity, several potential relationships can be hypothesized:

  • Energy metabolism: As part of Complex I, nuoK contributes to energy production through the respiratory chain, potentially supporting bacterial survival in the challenging CF lung environment.

  • Adaptation to microaerobic conditions: The CF lung presents a microaerobic environment, and respiratory chain adaptability may contribute to B. cepacia persistence.

  • pH homeostasis: The proton-pumping function of the antiporter module containing nuoK may contribute to pH regulation in acidic microenvironments within CF lungs.

  • Species-specific variations: Different Burkholderia species (e.g., B. cenocepacia and B. dolosa) demonstrate varying levels of pathogenicity , which may correlate with differences in respiratory chain function or regulation.

Research into these potential relationships would require carefully designed experimental approaches, including comparison of nuoK function between clinical isolates with varying virulence and the development of appropriate animal models that recapitulate CF lung conditions.

What novel experimental approaches could advance understanding of nuoK function in Burkholderia cepacia?

Several innovative experimental approaches could significantly advance understanding of nuoK function in B. cepacia:

These approaches would complement existing methodologies and potentially overcome current limitations in understanding the precise mechanisms by which nuoK contributes to B. cepacia physiology and pathogenicity.

How might nuoK be targeted in therapeutic development for Burkholderia cepacia infections?

The potential for targeting nuoK in therapeutic development for B. cepacia infections presents several avenues for research:

  • Specific inhibitors: Developing compounds that specifically target nuoK function could disrupt energy metabolism in B. cepacia without affecting human mitochondrial complex I, though achieving selectivity would be challenging.

  • Attenuated virulence: If nuoK function contributes to virulence or persistence in CF lungs, modulating its activity might reduce pathogenicity without directly killing bacteria, potentially reducing selective pressure for resistance.

  • Combination therapies: Inhibitors targeting nuoK could potentially sensitize B. cepacia to existing antibiotics by compromising energy production.

  • Species-specific targeting: Exploiting structural differences in nuoK between Burkholderia species might enable targeted therapy against the most virulent strains, such as B. cenocepacia and B. dolosa .

  • Diagnostic applications: Understanding nuoK variation across Burkholderia species could support development of rapid diagnostic tools to identify specific pathogenic strains.

Research in this direction would require thorough structural characterization of nuoK and its interactions within the respiratory complex, followed by high-throughput screening for potential inhibitors and extensive testing for specificity, efficacy, and resistance development potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.