Recombinant Burkholderia cepacia Probable intracellular septation protein A (BceJ2315_19460)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; BceJ2315_19460; BCAL1983; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315))
Target Names
BceJ2315_19460
Target Protein Sequence
MKFLFDLFPIILFFVAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFSKNLIEKMMGKQLTLPSPVWDKLN LAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia cepacia Probable intracellular septation protein A and what is its role in bacterial cells?

Burkholderia cepacia Probable intracellular septation protein A (BceJ2315_19460) is a protein involved in bacterial cell division processes, specifically in intracellular septation. This 176-amino acid protein belongs to the YciB family and plays a critical role in the formation of the septum during bacterial cell division . Its involvement in intracellular septation makes it an important protein for understanding fundamental bacterial cell division mechanisms. The protein is encoded by the BceJ2315_19460 gene, also known as BCAL1983, in Burkholderia cenocepacia strain J2315 .

The protein's functional significance extends beyond merely structural roles; it likely participates in protein-protein interactions that coordinate the complex process of bacterial cell division. Understanding this protein provides insights into fundamental bacterial cellular processes and potential antimicrobial targets.

How does BceJ2315_19460 differ from homologous proteins in other bacterial species?

While BceJ2315_19460 belongs to the YciB family of proteins found across various bacterial species, the Burkholderia cenocepacia variant exhibits specific adaptations that reflect its evolutionary context. Comparative sequence analysis reveals both conserved domains, essential for the core septation function, and variable regions that likely represent species-specific adaptations.

The protein from Burkholderia cenocepacia strain J2315 (also designated as LMG 16656, ATCC BAA-245, DSM 16553, and NCTC 13227) has been specifically characterized in research contexts . This strain is particularly notable as it was isolated from a cystic fibrosis patient, suggesting potential relevance to pathogenicity in immunocompromised hosts.

What expression systems yield optimal results for recombinant BceJ2315_19460 production?

Escherichia coli represents the predominant expression system for recombinant production of BceJ2315_19460. According to research data, the full-length protein (amino acids 1-176) has been successfully expressed in E. coli systems with N-terminal His-tags . This approach facilitates downstream purification while maintaining protein functionality.

For researchers considering expression system selection, the following comparative assessment may be helpful:

Expression SystemAdvantagesLimitationsYield Expectations
E. coliHigh yield, well-established protocols, cost-effectivePotential endotoxin contamination, lack of post-translational modificationsTypically 10-20 mg/L culture
Yeast systemsPost-translational modifications, secreted expression possibleLower yields, more complex media requirementsApproximately 5-10 mg/L culture
Insect cellsAdvanced folding machinery, suitable for complex proteinsHigher cost, longer production timeVariable, typically 1-5 mg/L culture

For most research applications, the E. coli expression system provides the optimal balance of yield, cost, and experimental utility for BceJ2315_19460 . The protein's relatively simple structure without complex post-translational modifications makes bacterial expression systems particularly suitable.

What purification strategies maximize BceJ2315_19460 activity and purity?

Affinity chromatography utilizing His-tag interactions represents the primary purification strategy for recombinant BceJ2315_19460. This approach enables selective capture of the target protein from complex lysates. Researchers should implement a multi-stage purification protocol:

  • Initial capture using immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar resins

  • Intermediate purification via ion exchange chromatography to remove remaining contaminants

  • Final polishing step using size exclusion chromatography to achieve >90% purity

For optimal results, purification buffers should contain stabilizing agents to maintain protein integrity throughout the process. The protein can be effectively stored in Tris-based buffer with 50% glycerol to maintain stability . Final product purity should exceed 90% as determined by SDS-PAGE analysis .

How can researchers effectively study BceJ2315_19460 interactions in bacterial septation processes?

Understanding BceJ2315_19460's role in bacterial septation requires sophisticated interaction studies. Several complementary approaches prove effective:

  • Co-immunoprecipitation experiments using antibodies against tagged BceJ2315_19460 to identify binding partners

  • Bacterial two-hybrid systems to screen for potential interacting proteins

  • Fluorescence microscopy with fluorescently labeled BceJ2315_19460 to visualize localization during cell division

  • Cryo-electron microscopy to examine structural context within the septation machinery

These approaches should be integrated with computational predictions of protein-protein interactions based on structural analysis. The hydrophobic regions within BceJ2315_19460 may facilitate membrane associations that are crucial to its septation function.

Researchers should design experiments that capture the dynamic nature of these interactions throughout the cell division cycle, rather than focusing solely on static interaction maps.

What storage protocols maximize stability and activity of purified BceJ2315_19460?

Maintaining stability of purified BceJ2315_19460 requires careful attention to storage conditions. Based on experimental data, the following protocols are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C to minimize freeze-thaw damage

  • Long-term storage: Store at -20°C or preferably -80°C in buffer containing cryoprotectants

  • Storage buffer formulation: Tris-based buffer with 50% glycerol, optimized for this specific protein

Critical considerations include avoiding repeated freeze-thaw cycles, which significantly diminish protein activity. Prior to opening stored samples, researchers should briefly centrifuge vials to bring contents to the bottom . For reconstitution of lyophilized protein, deionized sterile water should be used to achieve a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to a final concentration of 50% for optimal stability .

What experimental approaches best elucidate BceJ2315_19460 function in bacterial cell division?

To comprehensively investigate BceJ2315_19460 function, researchers should implement multiple complementary experimental approaches:

  • Gene knockout/knockdown studies to evaluate phenotypic consequences of BceJ2315_19460 deletion or reduction

  • Site-directed mutagenesis to identify critical functional residues within the protein

  • Super-resolution microscopy to visualize protein localization during different stages of cell division

  • In vitro reconstitution of minimal septation systems to assess functional contributions

For knockout studies, CRISPR-Cas9 systems adapted for Burkholderia species offer precise genomic editing capabilities. When evaluating phenotypic effects, researchers should quantify changes in cell morphology, septation efficiency, and growth kinetics under various environmental conditions.

Complementation experiments, where wild-type BceJ2315_19460 is reintroduced into knockout strains, provide crucial validation of observed phenotypes and help distinguish direct from indirect effects of protein absence.

How can researchers utilize structural biology approaches to understand BceJ2315_19460 mechanisms?

Structural characterization of BceJ2315_19460 provides essential insights into its functional mechanisms. Researchers should consider multiple structural biology techniques:

  • X-ray crystallography of purified recombinant protein to determine high-resolution 3D structure

  • Nuclear magnetic resonance (NMR) spectroscopy for solution-state structural analysis and dynamics

  • Cryo-electron microscopy for visualization of BceJ2315_19460 in native cellular contexts

  • Molecular dynamics simulations to predict conformational changes during protein function

For crystallization trials, researchers should screen various conditions with both His-tagged and tag-removed versions of the protein. The relatively small size (20.1 kDa) makes BceJ2315_19460 amenable to NMR studies, which can provide valuable information about dynamic properties not captured by static crystallographic methods.

Integration of structural data with functional assays enables mapping of structure-function relationships and identification of potential sites for targeted interventions or further mechanistic studies.

How can BceJ2315_19460 research contribute to understanding bacterial pathogenesis?

Burkholderia cenocepacia is a significant opportunistic pathogen, particularly in cystic fibrosis patients. Research into BceJ2315_19460 offers several pathways to understanding bacterial pathogenesis:

  • As a cell division protein, BceJ2315_19460 may influence bacterial replication rates during infection

  • Protein variants may contribute to strain-specific differences in virulence observed across Burkholderia isolates

  • The essential nature of cell division processes makes BceJ2315_19460 a potential antimicrobial target

Researchers investigating pathogenesis should examine expression patterns of BceJ2315_19460 during infection scenarios, potential interactions with host factors, and correlations between protein variants and clinical outcomes in infected patients.

The use of recombinant BceJ2315_19460 in immunological studies may also reveal whether this protein elicits specific host immune responses that contribute to infection dynamics or inflammation processes.

What computational approaches can predict BceJ2315_19460 function and interactions?

Advanced computational methods offer powerful tools for predicting BceJ2315_19460 functions and interactions:

  • Homology modeling based on related proteins with known structures

  • Molecular docking simulations to predict potential binding partners

  • Molecular dynamics simulations to explore conformational flexibility

  • Machine learning approaches to predict functional sites based on sequence patterns

These computational predictions should inform experimental design, particularly for interaction studies and mutagenesis experiments. When conducting homology modeling, researchers should consider both sequence similarity and structural conservation across the YciB protein family.

Integration of genomic context analysis, examining genes typically co-located with BceJ2315_19460 across bacterial species, can provide additional functional insights through the principle of guilt by association.

What are the key considerations for designing comprehensive BceJ2315_19460 research programs?

Researchers investigating BceJ2315_19460 should adopt integrated approaches that combine:

  • Structural biology to elucidate 3D architecture and functional domains

  • Molecular genetics to assess phenotypic consequences of protein modification

  • Cell biology to visualize protein dynamics during bacterial cell division

  • Biochemistry to characterize interaction networks and enzymatic activities

When designing experiments, researchers should consider the specific challenges associated with membrane-associated proteins, including solubility issues and the importance of maintaining native lipid environments for functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.