Recombinant Burkholderia cepacia Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Classification and Enzymatic Activity

The Burkholderia cepacia Protease HtpX homolog is classified as a zinc metalloprotease with the EC number 3.4.24.- . This classification indicates its enzymatic function as a peptidase that requires zinc for catalytic activity. The protein belongs to the M48 peptidase family, which typically contains a zinc-binding motif essential for its proteolytic function.

As a protease, HtpX is involved in the hydrolysis of peptide bonds, contributing to protein degradation and turnover within the bacterial cell. This enzymatic activity plays a crucial role in cellular processes such as protein quality control and stress responses, which are essential for bacterial survival under various environmental conditions.

Comparative Analysis with HtpX Homologs from Other Species

Comparing the Burkholderia cepacia HtpX homolog with homologs from other bacterial species reveals both conserved and variable regions, providing insights into evolutionary relationships and functional conservation. For instance, the Streptococcus pyogenes serotype M4 Protease HtpX homolog (UniProt ID: Q1J8D6) consists of 298 amino acids, slightly longer than the B. cepacia homolog .

Table 1: Comparison of HtpX Homologs from Different Bacterial Species

FeatureBurkholderia cepacia HtpXStreptococcus pyogenes HtpX
UniProt IDB4E7W0Q1J8D6
Length (amino acids)285298
Source OrganismBurkholderia cepacia (strain J2315)Streptococcus pyogenes serotype M4
EC Number3.4.24.-3.4.24.-
Gene NamehtpXhtpX
SynonymsBceJ2315_04660, BCAL0468MGAS10750_Spy0275
Expression SystemE. coliE. coli

Expression Systems and Protein Production

The recombinant production of Burkholderia cepacia Protease HtpX homolog has been successfully achieved using Escherichia coli as the expression host. According to commercial product information, the full-length protein (amino acids 1-285) has been expressed with an N-terminal His tag to facilitate purification and detection .

While specific expression vectors for B. cepacia HtpX are not detailed in the available data, similar recombinant proteins have utilized IPTG-inducible expression systems. For instance, research on related proteases has employed vectors containing IPTG-inducible promoters for controlled expression . These expression systems provide efficient production of the recombinant protein while allowing for precise control of expression timing and levels.

The expression in E. coli offers several advantages, including:

  • High protein yield

  • Well-established genetic manipulation techniques

  • Scalable production processes

  • Effective purification protocols

Purification Methods and Protein Quality

The purification of recombinant Burkholderia cepacia Protease HtpX homolog typically leverages the His-tag fusion for affinity chromatography. This approach enables selective binding of the recombinant protein to metal chelate resins (such as Ni-NTA), followed by elution with imidazole-containing buffers.

The purified protein achieved through these methods typically shows greater than 90% purity as determined by SDS-PAGE analysis . This high level of purity is essential for subsequent structural and functional studies, as well as for potential biotechnological applications.

Potential Involvement in Pathogenicity

The Burkholderia cepacia complex (Bcc) has emerged as significant opportunistic pathogens, particularly in immunocompromised individuals and patients with cystic fibrosis . These bacteria emerged in the 1980s as life-threatening pathogens among CF patients and have since been recognized as threats to other hospitalized patients, particularly those with oncological conditions .

Proteases, in general, often contribute to bacterial virulence through various mechanisms, including:

  • Tissue degradation

  • Immune evasion

  • Processing of other virulence factors

  • Adaptation to host environments

The genomes of Bcc bacteria, including B. cenocepacia strain J2315 (which contains the htpX gene), show significant genomic plasticity, with over 10% of their genomes acquired by horizontal gene transfer . This genomic plasticity contributes to their metabolic diversity and adaptability to various environments, including the CF lung.

Relationship to Virulence Mechanisms

The ability to withstand these stresses through effective protein quality control mechanisms is crucial for successful colonization and infection. Furthermore, the multidrug resistance characteristic of Bcc bacteria makes them particularly challenging to treat, highlighting the importance of understanding virulence factors that could serve as potential therapeutic targets.

Diagnostic Applications

The characterization of the Burkholderia cepacia Protease HtpX homolog opens possibilities for its use in diagnostic applications. Currently, commercial ELISA kits for this protein are available, suggesting its potential utility in detection systems . These diagnostic applications could include:

  • Immunodiagnostic assays using specific antibodies against this protein

  • Molecular diagnostic approaches targeting the htpX gene

  • Development of rapid detection methods for clinical samples

Such diagnostic tools could be particularly valuable in clinical settings where rapid identification of Bcc bacteria is crucial for appropriate treatment selection, especially given the intrinsic antimicrobial resistance of these pathogens.

Therapeutic Targets and Drug Development

Given the increasing problem of multidrug resistance in Bcc bacteria, novel therapeutic targets are urgently needed. Proteases like HtpX, which play roles in stress response and potentially in virulence, represent promising targets for new antimicrobial strategies.

The availability of recombinant HtpX protein enables:

  • High-throughput screening for inhibitors

  • Structure-based drug design approaches

  • Validation of target engagement in cellular systems

Inhibitors targeting the catalytic activity of HtpX could potentially disrupt protein quality control systems in B. cepacia, rendering the bacteria more susceptible to environmental stresses and host defense mechanisms. The development of such inhibitors would require detailed structural and functional characterization of the protease.

Biotechnological Applications

Beyond its significance in pathogenicity and potential as a therapeutic target, the Burkholderia cepacia Protease HtpX homolog may have applications in biotechnology. Proteases are widely used in various industrial processes, including in the food industry, detergent formulations, and biocatalysis.

The recombinant production methods described earlier provide a foundation for exploring such applications. The protein's enzymatic properties, substrate specificity, and stability under various conditions would need to be thoroughly characterized to assess its suitability for specific biotechnological applications.

Table 3: Potential Applications of Recombinant B. cepacia HtpX

Application DomainPotential Uses
DiagnosticsImmunodiagnostic assays; Molecular detection of Bcc bacteria
TherapeuticsTarget for novel antimicrobial agents; Structure-based drug design
BiotechnologyIndustrial enzymes; Biocatalysis; Protein engineering studies
Research ToolsStudying bacterial stress responses; Understanding virulence mechanisms

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development with your specified tag.
Synonyms
htpX; BceJ2315_04660; BCAL0468; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315))
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFSYWFSDKMVLRMYNAQ EVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTITATMAGAISALANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQSLATALDKIHRYAAGIPFQAAEA HPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMARTGRFD
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Burkholderia cepacia Protease HtpX homolog?

Burkholderia cepacia Protease HtpX homolog (htpX) is a membrane-bound zinc metalloproteinase belonging to the M48 family. The protein consists of 285 amino acid residues with a complete sequence of MFNWVKTAMLMAAITAIFIVIGGMIGGSR GMTIALLFALGMNFFSYWFSDKMVLRMYNAQEVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTITATMAGAISALANFAMFFGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQSLATALDKIHRYAAGIPFQAAEAHPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMARTGRFD .

The protein contains multiple hydrophobic regions that likely function as transmembrane segments, similar to its E. coli homolog. The strain J2315 variant is cataloged under UniProt number B4E7W0, with ordered locus names BceJ2315_04660 and ORF name BCAL0468 .

What is the primary function of HtpX proteases in bacterial systems?

HtpX proteases function predominantly in quality control of membrane proteins. Based on studies of homologous systems, particularly in E. coli, HtpX eliminates malfolded and/or misassembled membrane proteins that could potentially disrupt membrane structure and function . This proteolytic quality control is critical for maintaining normal cellular activities and bacterial homeostasis. As a membrane-integrated zinc metalloproteinase, HtpX participates in the degradation pathway of proteins that might otherwise compromise membrane integrity. The enzyme is classified with EC number 3.4.24.-, indicating its metalloprotease activity .

How does Burkholderia cepacia HtpX compare with homologs in other bacterial species?

The Priestia megaterium DX-3 htpX homolog has been characterized as a neutral, heat-resistant metalloprotease with an M48 peptidase domain, with Ca²⁺ binding leading to the formation of an active pocket . This suggests possible differences in activation mechanisms and substrate specificity across bacterial species, which may reflect adaptation to different ecological niches.

What are the recommended conditions for storing and handling recombinant B. cepacia HtpX protein?

For optimal stability and activity preservation of recombinant B. cepacia HtpX protein, implement the following protocol:

Storage Conditions:

  • Primary storage: -20°C (short-term) or -80°C (extended storage)

  • Working aliquots: 4°C for up to one week

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles as these significantly reduce enzymatic activity

  • Prepare single-use aliquots during initial thawing to minimize degradation

  • When handling the 50 μg standard quantity, maintain sterile technique to prevent contamination

These conditions are designed to maintain the structural integrity and catalytic activity of the metalloprotease domains critical for experimental reproducibility.

What expression systems are most effective for producing recombinant B. cepacia HtpX?

Based on analysis of successful expression strategies for membrane-bound metalloproteases, the following expression systems have demonstrated efficacy for recombinant B. cepacia HtpX production:

Table 1: Comparative Analysis of Expression Systems for HtpX Production

Expression SystemAdvantagesChallengesYield PotentialRecommended Applications
E. coli BL21(DE3)Rapid growth, economical, well-established protocolsPotential inclusion body formation, may lack post-translational modificationsModerate to highInitial characterization, structural studies
P. pastorisBetter folding of complex proteins, glycosylation potentialLonger expression time, more complex protocolsModerateFunctional studies requiring proper folding
Baculovirus-insect cellSuperior for membrane proteins, better solubilityHigher cost, technical complexityModerate to highAdvanced functional and structural studies

When expressing Burkholderia metalloproteases like HtpX, researchers should consider the demonstrated success with homologous proteins. For instance, the recombinant expression of DX-3-htpX protease achieved a 61.9-fold increase in fermentation level compared to the native DX-3 protease , suggesting that optimized expression systems can dramatically improve yields.

What assay methods are available for measuring B. cepacia HtpX protease activity?

Several assay methods have been developed for measuring protease activity of metalloproteases like B. cepacia HtpX:

  • Model Substrate-Based Assays: Following the approach used for E. coli HtpX, researchers can develop model substrates specific to B. cepacia HtpX. Such systems allow semiquantitative and convenient measurement of protease activity in vivo .

  • Fluorogenic Peptide Substrates: Using peptides that release fluorescent moieties upon cleavage, researchers can quantitatively measure protease activity. This method is especially useful for kinetic studies.

  • Immunoblotting Detection System: For in vivo activity assessment, Western blot analysis using antibodies specific to cleaved fragments can detect differential protease activities, particularly when testing HtpX mutants with mutations in conserved regions .

  • FRET-Based Assays: Employing fluorescence resonance energy transfer substrates provides high sensitivity for detecting protease activity in real-time conditions.

When designing activity assays, it's essential to account for the membrane-associated nature of the enzyme and its zinc-dependent metalloprotease activity.

How does B. cepacia HtpX contribute to bacterial pathogenesis in cystic fibrosis patients?

B. cepacia HtpX likely plays a multifaceted role in pathogenesis within cystic fibrosis (CF) patients through several mechanisms:

  • Membrane Protein Quality Control: As a membrane-integrated protease, HtpX maintains membrane integrity under stress conditions encountered in the CF lung environment, including oxidative stress and antimicrobial peptides .

  • Virulence Factor Regulation: Although direct evidence is still emerging, proteases like HtpX may process or activate virulence factors necessary for colonization and infection persistence.

  • Stress Response Pathway: Burkholderia cepacia complex (Bcc) species show remarkable adaptability to diverse environments, facilitated by quality control systems like HtpX that maintain cellular homeostasis during stress .

  • Genomic Plasticity Contribution: The significant genomic diversity observed in Bcc (with B. cenocepacia showing 21% genomic uniqueness) suggests that genes like htpX may be subject to selection pressures that enhance pathogenic potential in specific host niches .

The role of HtpX should be considered within the broader context of Bcc pathogenesis, where multiple chromosomal replicons encode numerous drug- and virulence-resistant genes that contribute to metabolic versatility and environmental adaptability .

What mechanisms regulate HtpX expression and activity in B. cepacia?

Regulation of HtpX expression and activity in B. cepacia involves multiple layers of control that respond to environmental and cellular stressors:

Transcriptional Regulation:

  • Stress-responsive sigma factors likely upregulate htpX expression under membrane stress conditions

  • The presence of recombination events in Bcc core genomes (affecting approximately 5.8% of core orthologous genes) suggests potential gene expression diversity across strains

Post-translational Regulation:

  • Metal ion binding, particularly zinc, is essential for catalytic activity

  • Evidence from related proteases indicates that calcium binding can significantly affect active site formation, as seen with the DX-3-htpX protease where Ca²⁺ binding results in the formation of the largest active pocket

Substrate Availability Regulation:

Understanding these regulatory mechanisms is crucial for interpreting HtpX function in different experimental contexts and for developing strategies to modulate its activity in research applications.

What are the implications of positive selection and recombination in the evolution of B. cepacia htpX?

The evolutionary forces shaping B. cepacia htpX have significant implications for bacterial adaptation and pathogenesis:

Recombination Effects:

  • Genome-wide studies of the Burkholderia cepacia complex (Bcc) demonstrate that approximately 5.8% of core orthologous genes show strong evidence of recombination

  • Homologous recombination contributes significant genetic variation to numerous genes and maintains genetic cohesion within Bcc

  • This high recombination level between Bcc species blurs taxonomic boundaries, making species difficult to distinguish phenotypically and genotypically

Positive Selection Influence:

  • While only 1.1% of core orthologous genes in Bcc show evidence of positive selection, genes involved in protein synthesis and material transport/metabolism are favored by selection pressure

  • Proteases like HtpX may be under selective pressure due to their role in degrading misfolded proteins that could otherwise trigger host immune responses

Evolutionary Implications:

  • The selective pressures on htpX may reflect adaptation to specific host environments or stress conditions

  • Understanding the evolutionary trajectory of htpX could provide insights into the adaptation of B. cepacia to clinical environments, particularly in chronic infection settings

These evolutionary mechanisms contribute to the genomic plasticity of Bcc species, which encode extensive functions with metabolic versatility allowing adaptation to diverse environments .

What are common challenges in purifying active recombinant B. cepacia HtpX and how can they be addressed?

Purification of active recombinant B. cepacia HtpX presents several technical challenges due to its membrane-integrated nature. Here are common issues and their solutions:

Challenge 1: Low solubility

  • Solution: Incorporate detergents appropriate for membrane proteins (e.g., n-dodecyl-β-D-maltoside or CHAPS) during extraction

  • Methodological approach: Optimize detergent concentration through small-scale extractions with activity testing to ensure maintained function

Challenge 2: Loss of zinc coordination and catalytic activity

  • Solution: Include zinc supplementation (typically 5-10 μM ZnCl₂) in all purification buffers

  • Validation method: Compare activity with and without zinc supplementation to confirm metal dependency

Challenge 3: Protein aggregation during concentration

  • Solution: Add glycerol (10-50%) to stabilize protein structure during concentration steps

  • Supporting evidence: Storage recommendations for commercial preparations include 50% glycerol for stability

Challenge 4: Heterologous expression toxicity

  • Solution: Use tightly controlled inducible systems with low-level expression or specialized host strains

  • Alternative approach: Consider cell-free expression systems that circumvent toxicity issues

Challenge 5: Inclusion body formation

  • Solution: Lower induction temperature (16-18°C) and induce with reduced inducer concentration

  • Refolding strategy: If inclusion bodies form, develop careful refolding protocols with gradual detergent introduction

Researchers should validate active conformations through activity assays with model substrates similar to those developed for E. coli HtpX .

How can researchers differentiate between the activity of B. cepacia HtpX and other proteases in experimental systems?

Distinguishing B. cepacia HtpX activity from other proteases requires carefully designed experimental approaches:

Specific Inhibitor Profile:
Develop an inhibitor panel to create a characteristic fingerprint:

  • Metalloprotease inhibitors (EDTA, 1,10-phenanthroline): Should inhibit HtpX

  • Serine protease inhibitors (PMSF): Should not affect HtpX

  • Cysteine protease inhibitors (E-64): Should not affect HtpX

  • Aspartic protease inhibitors (pepstatin A): Should not affect HtpX

Substrate Specificity Analysis:
Design experiments using model substrates with varying cleavage sites, similar to the XMS1 (HtpX model substrate 1) approach used for E. coli HtpX .

Genetic Deletion and Complementation:

  • Generate htpX knockout strains

  • Compare protease activity profiles between wild-type and knockout

  • Complement with wild-type and mutant htpX to confirm specificity

Recombinant Expression with Mutations:
Create variants with mutations in the zinc-binding HEXXH motif characteristic of metalloproteases to demonstrate specificity of the observed activity.

Western Blot Detection:
Develop antibodies that specifically recognize cleavage products generated by HtpX, allowing for discrimination from other protease activities.

The combined approach using multiple methods provides more robust evidence for HtpX-specific activity than any single method alone.

What are promising research avenues for understanding B. cepacia HtpX's role in antimicrobial resistance?

Several research directions could elucidate the potential role of B. cepacia HtpX in antimicrobial resistance:

  • Stress Response Integration: Investigate how HtpX activity changes during exposure to different classes of antibiotics, particularly those targeting cell envelope integrity. This may reveal roles in membrane remodeling during antimicrobial stress.

  • Resistance Protein Processing: Examine whether HtpX processes or degrades specific membrane proteins involved in antimicrobial efflux or resistance mechanisms. Proteomics approaches comparing wild-type and htpX-deficient strains under antibiotic stress could identify relevant substrates.

  • Biofilm Formation Contribution: Explore HtpX's potential role in biofilm development, as Bcc species encode extensive functions for metabolic versatility and environmental adaptation . Biofilms significantly contribute to antimicrobial tolerance.

  • Comparative Analysis Across Resistant Isolates: Sequence and expression analysis of htpX across clinical isolates with varying resistance profiles could reveal adaptations or expression patterns correlating with resistance phenotypes.

  • Inhibitor Development: Design specific inhibitors of HtpX to determine whether its inhibition sensitizes B. cepacia to antibiotics, potentially revealing new combination therapy approaches.

Understanding HtpX's role may provide insights into the remarkable adaptability of Bcc species, which have large genomes with multiple chromosomal replicons encoding numerous drug-resistant genes .

How might structure-function studies of B. cepacia HtpX inform therapeutic development?

Structure-function studies of B. cepacia HtpX could significantly impact therapeutic development through several approaches:

Essential Structural Elements:

  • Mapping the zinc-binding domain and catalytic residues

  • Identifying membrane topology and accessibility of catalytic sites

  • Determining substrate binding pockets and specificity determinants

Comparative Structural Analysis:
By examining structural differences between HtpX from human and bacterial sources, researchers could identify bacterial-specific features to target. For example, the finding that Ca²⁺ binding to recombinant DX-3-htpX protease results in the formation of the largest active pocket suggests that metal coordination could be a target for interference.

Potential Therapeutic Approaches:

  • Allosteric Inhibitors: Targeting non-catalytic sites that regulate HtpX activity

  • Competitive Inhibitors: Designing substrate mimics that occupy the active site

  • Destabilizing Compounds: Developing molecules that disrupt proper folding or membrane integration

  • Metal Chelators: Creating compounds that specifically disrupt zinc coordination in the bacterial enzyme

Experimental Validation Pathway:

  • Structural determination (X-ray crystallography or cryo-EM)

  • In silico docking studies with virtual compound libraries

  • Biochemical validation with recombinant enzyme

  • Cellular studies in B. cepacia

  • Animal model validation

These approaches could lead to novel therapeutics targeting a system critical for bacterial membrane protein quality control and stress response.

What are the most significant unresolved questions regarding B. cepacia HtpX?

Despite progress in understanding HtpX proteases, several critical questions remain unanswered regarding the B. cepacia homolog:

  • Physiological Substrates: The natural substrates of B. cepacia HtpX remain largely unidentified. Developing methods to identify these substrates would significantly advance understanding of its biological role.

  • Regulatory Networks: The precise signals and transcription factors that control htpX expression in B. cepacia during infection and stress response are not fully characterized.

  • Structural Determinants of Specificity: While HtpX is known to be a membrane metalloprotease, the specific structural features that differentiate its activity from homologs in other species require further elucidation.

  • Contribution to Virulence: The direct contribution of HtpX to B. cepacia pathogenesis, particularly in cystic fibrosis infections, requires systematic investigation through appropriate animal models.

  • Evolutionary Trajectory: How recombination and selection have shaped htpX function within the Burkholderia cepacia complex remains an area requiring further genomic and phylogenetic analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.