Recombinant Burkholderia cepacia Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; BceJ2315_30100; BCAL3063; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315))
Target Names
crcB
Target Protein Sequence
MFYSIVAIFVGAGLGALLRWCLSLTLNAFFPAVPLGTLAANLLGGYVIGVAAVVFTVRVG LPPEWRLFVITGFLGGLTTFSTYSVEVMTHALEGEFGWALAVAALHLTGSFALTALGMWT ARAWLAAA
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of CrcB protein in Burkholderia cepacia Complex (Bcc) species?

CrcB proteins in Burkholderia cepacia Complex (Bcc) species primarily function as membrane proteins involved in fluoride transport. While previously implicated in chromosome condensation and camphor resistance, current research strongly supports their role as fluoride transporters that reduce cellular concentrations of this potentially toxic anion . Experimental evidence demonstrates that CrcB knockout (KO) strains exhibit significantly decreased tolerance to fluoride compared to wild-type strains. Specifically, CrcB knockout strains show growth inhibition at much lower fluoride concentrations than wild-type cells, indicating that CrcB protein plays a crucial role in reducing intracellular fluoride concentrations to mitigate toxicity .

How is crcB expression regulated in bacterial systems?

The expression of crcB in bacterial systems is predominantly regulated through fluoride-responsive riboswitches located in the messenger RNA upstream of the crcB gene. These specialized RNA structures undergo conformational changes upon binding to fluoride ions, which subsequently activates the expression of fluoride resistance genes including crcB . In-line probing experiments with crcB motif RNAs from various organisms, including Pseudomonas syringae, demonstrate significant structural changes upon fluoride addition, with apparent dissociation constants (KD) of approximately 60 μM . The riboswitches exhibit remarkable selectivity for fluoride over other anions, including chloride, and operate through mechanisms such as controlling the formation of intrinsic transcription terminators or regulating translation initiation, depending on the specific organism .

What experimental methods are most effective for studying crcB expression?

For studying crcB expression, several methodological approaches have proven effective:

  • Reporter gene constructs: Creating transcriptional or translational fusions between the crcB motif RNA and reporter genes like lacZ has been successfully employed to monitor gene expression. This approach allows researchers to quantitatively assess how fluoride concentrations affect crcB expression .

  • In-line probing: This technique is valuable for assessing structural changes in crcB motif RNAs upon binding to fluoride. It helps determine the binding affinity (KD) and specificity of the interaction .

  • Growth curve analysis: Comparing growth curves of wild-type and crcB knockout strains at various fluoride concentrations provides functional evidence of CrcB's role in fluoride resistance .

  • Comparative genomic analysis: This approach helps identify conserved crcB motifs across bacterial species and understand their evolutionary relationships .

What is the relationship between the crcB gene and fluoride riboswitches?

The crcB gene and fluoride riboswitches share an intimate functional relationship in bacterial systems. The crcB motif RNA structures function as selective fluoride sensors that activate expression of genes encoding proteins that alleviate fluoride toxicity. When fluoride concentrations reach potentially harmful levels, these riboswitches undergo conformational changes that result in increased expression of the crcB gene .

Experimental evidence demonstrates this relationship through reporter constructs. For example, when a fluoride riboswitch from Pseudomonas syringae eriC gene was joined to lacZ and transformed into Escherichia coli, high expression occurred when cells were grown on media supplemented with 50 mM fluoride, while lower fluoride concentrations resulted in minimal expression . Mutational analysis of these riboswitches further confirms their role in fluoride-responsive regulation of gene expression through mechanisms controlling translation initiation or transcription termination .

How do recombination and positive selection influence crcB evolution in the Burkholderia cepacia Complex?

Recombination and positive selection are critical evolutionary forces shaping the crcB gene in Burkholderia cepacia Complex (Bcc) species. Comparative genomic analysis of the core genome of 116 Bcc strains reveals that:

  • Recombination prevalence: Approximately 5.8% of core orthologous genes in Bcc strongly support recombination events . This homologous recombination contributes substantial genetic variation and largely maintains genetic cohesion within the complex .

  • Positive selection: About 1.1% of core orthologous genes show evidence of positive selection . Genes involved in protein synthesis, material transport, and metabolism (potentially including crcB) appear to be favored by selection pressure .

  • Taxonomic implications: The high level of recombination between Bcc species significantly blurs taxonomic boundaries, making species within the complex difficult or impossible to distinguish based solely on phenotypic or genotypic characteristics .

Methodologically, researchers investigating crcB evolution should employ both phylogenetic approaches and population genetics methods to detect recombination signals and identify positively selected sites within the gene sequence. Advanced computational tools that can distinguish between ancestral recombination and recent horizontal gene transfer events are particularly valuable for understanding the evolutionary history of crcB in Burkholderia species.

What are the structural determinants of CrcB protein that confer fluoride specificity and transport capability?

The structural determinants conferring fluoride specificity to CrcB proteins involve several key features:

  • Membrane topology: CrcB proteins are predicted to be membrane proteins belonging to a transporter superfamily . Their membrane integration is crucial for facilitating fluoride transport across bacterial cell membranes.

  • Ion selectivity: The remarkable selectivity of the associated crcB motif RNA for fluoride over chloride suggests that the binding pocket likely exploits fluoride's unique properties, including:

    • Smaller ionic radius (0.133 nm for fluoride versus 0.181 nm for chloride)

    • Unique hydrogen-bonding capabilities

  • Potential cofactor interaction: The polyanionic crcB motif RNAs may exploit magnesium ions (Mg²⁺) to form bridging contacts between anionic fluoride and nucleotides .

Experimental approaches to study these structural determinants should include:

  • Site-directed mutagenesis of conserved residues

  • Structural studies using X-ray crystallography or cryo-electron microscopy

  • Fluoride transport assays comparing wild-type and mutant CrcB proteins

  • Molecular dynamics simulations to model ion-protein interactions

How does the diversity of CDI systems in Burkholderia species impact crcB function and expression?

The Contact-Dependent Growth Inhibition (CDI) systems in Burkholderia species exhibit considerable diversity, which may impact crcB function and expression through complex regulatory networks. Analysis of the relationship reveals:

  • CDI system diversity: Bioinformatic analysis suggests that genes encoding CDI systems are prevalent among Bcc strains but not present in every sequenced isolate. Approximately 56% of Burkholderia cepacia strains contain putative bcpAIOB genes . These CDI systems show remarkable diversity, with most not fitting neatly into previously established subclasses .

  • Regulatory interactions: While direct evidence linking CDI systems and crcB regulation is limited, both systems appear to be involved in bacterial stress responses. CDI systems mediate competitive interactions between bacteria, while crcB responds to fluoride stress .

  • Methodological approach to study interactions:

    • Transcriptomic analysis comparing crcB expression in strains with and without functional CDI systems

    • Dual fluorescent reporter systems to simultaneously monitor CDI and crcB activity under various stress conditions

    • Creation of double knockout strains (ΔcrcB and ΔCDI components) to assess phenotypic interactions

What are the technical challenges in expressing and purifying recombinant CrcB protein for structural studies?

Expressing and purifying recombinant CrcB protein presents several technical challenges that researchers must address:

  • Membrane protein solubility: As a predicted membrane protein , CrcB is likely hydrophobic and difficult to maintain in solution without appropriate detergents or membrane mimetics.

  • Expression system selection: Challenges in heterologous expression include:

    • Potential toxicity to expression hosts

    • Proper membrane insertion and folding

    • Post-translational modifications

  • Purification strategy optimization:

    • Detergent screening to maintain native conformation

    • Affinity tag position optimization to avoid interfering with function

    • Stability during concentration and storage

  • Methodological approaches:

    • Use specialized expression systems for membrane proteins (e.g., C43(DE3) E. coli strain)

    • Employ fusion partners to enhance solubility

    • Consider cell-free expression systems

    • Use fluorescence-detection size exclusion chromatography (FSEC) to assess protein quality

    • Validate function of purified protein through fluoride transport assays

How can researchers design effective knockout and complementation studies for crcB in Burkholderia species?

Designing effective knockout and complementation studies for crcB in Burkholderia species requires careful consideration of several methodological aspects:

  • Knockout strategy selection:

    • Allelic replacement using homologous recombination

    • CRISPR-Cas9 gene editing for precise modifications

    • Transposon mutagenesis for random insertional inactivation

  • Verification of knockout:

    • PCR confirmation of gene deletion/disruption

    • RT-PCR to confirm absence of transcript

    • Western blotting if antibodies are available

    • Phenotypic confirmation through fluoride sensitivity assays

  • Complementation approaches:

    • Integration of wild-type crcB at a neutral chromosomal site

    • Plasmid-based complementation with tunable expression

    • Use of native promoter to maintain physiological expression levels

  • Experimental validation:

    • Growth curve analysis at different fluoride concentrations

    • Reporter gene assays to monitor fluoride riboswitch activation

    • Direct fluoride transport measurements using fluoride-selective electrodes

Existing research demonstrates that E. coli crcB knockout strains exhibit impaired growth at 50 mM fluoride concentrations and show high reporter gene expression even at low (0.2 mM) fluoride concentrations, indicating loss of fluoride resistance . Similar methodological approaches can be adapted for Burkholderia species with appropriate modifications for their genetic manipulation.

What are the optimal conditions for assaying CrcB-mediated fluoride transport in vitro?

Establishing optimal conditions for assaying CrcB-mediated fluoride transport in vitro requires careful consideration of several experimental parameters:

  • Membrane system selection:

    • Proteoliposomes reconstituted with purified CrcB

    • Bacterial membrane vesicles from cells overexpressing CrcB

    • Planar lipid bilayers for electrophysiological measurements

  • Buffer composition optimization:

    • pH range testing (typically 6.0-8.0)

    • Ionic strength adjustment (100-300 mM)

    • Divalent cation concentration (particularly Mg²⁺, which may be involved in fluoride binding)

    • Compatible buffer systems that don't interfere with fluoride detection

  • Fluoride detection methods:

    • Fluoride-selective electrodes for direct measurement

    • Fluorescent indicators sensitive to fluoride concentration

    • Radioactive ¹⁸F for trace level detection

  • Control experiments:

    • Heat-inactivated CrcB protein as negative control

    • Known fluoride transport inhibitors

    • Competition experiments with other anions

  • Data analysis:

    • Initial rate determination

    • Michaelis-Menten kinetics for transport characterization

    • Hill coefficient calculation to assess cooperativity

Based on previous studies of fluoride toxicity to bacterial cells, relevant fluoride concentration ranges should span from 0.2 mM to 50 mM, as these concentrations have been shown to affect bacterial growth and gene expression in wild-type and crcB knockout strains .

How should researchers approach the characterization of crcB homologs across diverse bacterial species?

Characterization of crcB homologs across diverse bacterial species requires a comprehensive approach that integrates bioinformatic, genetic, and biochemical methodologies:

  • Bioinformatic analysis:

    • Sequence alignment to identify conserved motifs

    • Phylogenetic analysis to establish evolutionary relationships

    • Structural prediction to identify potential functional domains

    • Genomic context analysis to identify associated genes

  • Comparative functional characterization:

    • Heterologous expression in a common host lacking endogenous crcB

    • Complementation assays in crcB knockout strains

    • Fluoride sensitivity testing across concentration gradients

    • Quantitative assessment of fluoride transport rates

  • Associated riboswitch characterization:

    • Identification of crcB motif RNAs in diverse species

    • In-line probing to assess structural changes upon fluoride binding

    • Determination of dissociation constants (KD) for different homologs

    • Reporter gene assays to compare expression regulation

  • Methodology for cross-species comparison:

    • Standardized assay conditions to enable direct comparison

    • Creation of chimeric proteins to identify species-specific functional domains

    • Correlation of environmental fluoride exposure with crcB diversity

How can researchers reconcile conflicting data on crcB function between different experimental systems?

Reconciling conflicting data on crcB function between different experimental systems requires systematic analysis and careful consideration of multiple factors:

For example, conflicting data might emerge from studies focused on crcB's role in chromosome condensation versus fluoride transport . Researchers should design experiments that can simultaneously assess both functions, perhaps by examining chromosome structure in response to fluoride exposure in wild-type versus crcB knockout strains.

What statistical approaches are most appropriate for analyzing crcB expression data across different experimental conditions?

The analysis of crcB expression data across different experimental conditions requires appropriate statistical approaches to ensure robust and meaningful interpretation:

  • Experimental design considerations:

    • Include sufficient biological and technical replicates (minimum n=3)

    • Account for batch effects through experimental blocking

    • Include appropriate positive and negative controls

    • Design factorial experiments to detect interaction effects

  • Recommended statistical methods:

    • For comparing two conditions: Student's t-test or Mann-Whitney U test

    • For multiple conditions: ANOVA with appropriate post-hoc tests

    • For time-course data: Repeated measures ANOVA or mixed effects models

    • For complex experimental designs: Generalized linear models

  • Normalization approaches:

    • For qRT-PCR: Use multiple reference genes validated for stability

    • For RNA-seq: TPM, RPKM, or DESeq2 normalization

    • For reporter assays: Normalize to cell density and positive controls

  • Data visualization:

    • Box plots showing distribution of expression values

    • Line graphs for concentration-dependent or time-course experiments

    • Heat maps for comparing expression across multiple conditions

    • Scatter plots with regression lines for correlation analysis

When interpreting crcB expression data, it's important to consider the relationship between expression level and functional outcomes. For example, research has shown that reporter gene expression driven by fluoride riboswitches increases proportionally with fluoride concentration until reaching toxic levels that inhibit cell growth .

How should researchers interpret evolutionary analyses of crcB in the context of bacterial adaptation to fluoride?

Interpreting evolutionary analyses of crcB requires a nuanced approach that considers multiple factors affecting bacterial adaptation to fluoride:

  • Evolutionary signatures to examine:

    • Sequence conservation patterns in coding and regulatory regions

    • Evidence of positive selection versus purifying selection

    • Recombination events affecting gene structure and function

    • Horizontal gene transfer between bacterial species

  • Ecological context consideration:

    • Environmental fluoride exposure in different bacterial habitats

    • Co-evolution with other fluoride resistance mechanisms

    • Relationship between fluoride resistance and pathogenicity

    • Trade-offs between fluoride resistance and other adaptive traits

  • Methodological approaches for interpretation:

    • Phylogenetic comparative methods to control for shared ancestry

    • Molecular clock analyses to date key evolutionary events

    • Population genetics frameworks to assess selection within species

    • Ancestral sequence reconstruction to trace functional evolution

  • Integration with experimental data:

    • Functional testing of ancient or intermediate sequences

    • Correlation between evolutionary rate and functional importance

    • Experimental evolution under fluoride selection pressure

Research indicates that approximately 5.8% of core orthologous genes in Burkholderia cepacia Complex strongly support recombination, while 1.1% show evidence of positive selection . The high level of recombination between Bcc species blurs taxonomic boundaries and likely contributes to the complex's adaptability to various environmental stresses, potentially including fluoride exposure .

How can crcB research inform the development of novel antimicrobial strategies targeting fluoride transport?

Research on crcB can inform the development of novel antimicrobial strategies through several potential mechanisms:

  • Target-based drug discovery:

    • Inhibition of CrcB protein to increase bacterial sensitivity to fluoride

    • Design of small molecules that mimic fluoride but block transport

    • Identification of critical residues for rational drug design

    • Combination therapy with fluoride and CrcB inhibitors

  • Riboswitch-targeting approaches:

    • Development of compounds that lock fluoride riboswitches in inactive conformations

    • Antisense oligonucleotides targeting the crcB motif RNA

    • RNA-binding small molecules that prevent riboswitch function

  • Methodological considerations for drug development:

    • High-throughput screening for CrcB inhibitors

    • Structure-based virtual screening once CrcB structure is determined

    • Whole-cell assays measuring bacterial survival in fluoride with candidate inhibitors

    • Medicinal chemistry optimization of lead compounds

  • Translational research directions:

    • Species-specific targeting of pathogenic Burkholderia

    • Assessment of resistance development through experimental evolution

    • In vivo efficacy testing in infection models

    • Delivery strategies for fluoride-based antimicrobials

The finding that crcB knockout strains exhibit drastically increased sensitivity to fluoride suggests that CrcB inhibitors could potentially sensitize pathogenic bacteria to fluoride treatment. This approach might be particularly valuable for addressing Burkholderia cepacia Complex infections in cystic fibrosis patients, where these bacteria can cause severe infections .

What are the most promising future research directions for understanding crcB function in bacterial physiology?

Several promising research directions could significantly advance our understanding of crcB function in bacterial physiology:

  • Structural biology approaches:

    • Determination of CrcB protein structure through X-ray crystallography or cryo-EM

    • Characterization of conformational changes during transport cycle

    • Structural basis of fluoride selectivity

    • Interaction with membrane lipids and potential protein partners

  • Systems biology integration:

    • Global transcriptomic and proteomic responses to fluoride stress

    • Metabolic remodeling during fluoride exposure

    • Interaction networks involving CrcB and other stress response systems

    • Mathematical modeling of fluoride homeostasis

  • Environmental and ecological studies:

    • Natural fluoride exposure of different bacterial species

    • Distribution and diversity of crcB in environmental samples

    • Role in bacterial communities and biofilms

    • Co-evolution with host defense mechanisms

  • Advanced functional characterization:

    • Single-molecule fluoride transport measurements

    • In vivo fluoride concentration dynamics using fluorescent sensors

    • Role in bacterial survival under fluctuating environmental conditions

    • Potential secondary functions beyond fluoride transport

  • Methodological innovations needed:

    • Development of fluoride-specific biosensors with improved sensitivity

    • Techniques for visualizing CrcB localization and dynamics in living cells

    • High-throughput methods for assessing fluoride transport

    • Computational approaches for predicting fluoride-protein interactions

The interconnection between recombination, positive selection, and functional diversity in Burkholderia cepacia Complex provides a rich framework for investigating how crcB has evolved to fulfill its role in bacterial physiology and how this knowledge might be applied to address infections caused by these opportunistic pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.