Recombinant Burkholderia glumae Lipase chaperone (lifO)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipase Folding

Lif facilitates the transition of denatured or misfolded lipase into its active α/β-hydrolase fold, which includes a calcium-binding site and a disulfide bond . Key findings include:

  • Kinetic Trapping: Lipase refolds spontaneously into an inactive near-native intermediate (LipAi) in the absence of Lif. This conformation is protease-resistant but enzymatically inactive .

  • Steric Assistance: Lif binds LipAi and induces a conformational change, allowing the lipase to adopt its native, active state (LipAn) .

  • Protease Resistance: Native LipAn exhibits enhanced stability against heat and proteolysis compared to LipAi .

Mechanistic Model

  1. Denaturation: Lipase unfolds into a linear polypeptide.

  2. Spontaneous Refolding: Forms LipAi (inactive, near-native).

  3. Lif-Mediated Activation: Lif binds LipAi, overcoming a kinetic barrier to form LipAn (active) .

Research Findings and Applications

  • Industrial Relevance: B. glumae lipase is used in biocatalysis for ester hydrolysis and enantioselective synthesis . Lif’s role in ensuring proper folding is critical for maintaining enzymatic activity.

  • Strain Engineering: Overexpression of lipAB (lipase + Lif) in B. glumae LU8093 enhances lipase production, particularly when combined with additives like hexadecane .

  • Mechanistic Parallels: Lif’s function mirrors propeptides in proteases (e.g., subtilisin), but its α-helical structure distinguishes it from β-sheet-rich prodomains .

Key Studies

  1. Folding Intermediates (PLOS ONE, 2012):
    Demonstrated that LipAi is kinetically trapped and requires Lif for activation. Introduced the concept of a "molten globule-like" intermediate under denaturing conditions .

  2. Structural Elucidation (Nat. Struct. Mol. Biol., 2006):
    Visualized Lif’s α-helical structure and its interaction with lipase, providing a blueprint for chaperone-mediated folding .

  3. Production Optimization (PMC, 2007):
    Showed that hexadecane and detergents enhance lipase production post-transcriptionally, likely by stabilizing periplasmic folding intermediates .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lifO; lipB; Lipase-specific foldase; Lif; Lipase activator protein; Lipase chaperone; Lipase helper protein; Lipase modulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Burkholderia glumae (Pseudomonas glumae)
Target Names
lifO
Target Protein Sequence
MAQADRPARGGLAARPMRGASFALAGLVACAACAAVVLWLRPAAPSPAPAGAVAGGPAAG VPAAASGAAEAAMPLPAALPGALAGSHAPRLPLAAGGRLARTRAVREFFDYCLTAQGELT PAALDALVRREIAAQLDGSPAQAEALGVWRRYRAYFDALAQLPGDGAVLGDKLDPAAMQL ALDQRAALADRTLGEWAEPFFGDEQRRQRHDLERIRIANDTTLSPEQKAARLAALDAQLT PDERAQQAALHAQQDAVTKIADLQKAGATPDQMRAQIAQTLGPEAAARAAQMQQDDEAWQ TRYQAYAAERDRIAAQGLAPQDRDARIAQLRQQTFTAPGEAIRAASLDRGAGG
Uniprot No.

Target Background

Function
This protein is involved in the periplasmic folding of extracellular lipase (lip).
Protein Families
Lipase chaperone family
Subcellular Location
Cell inner membrane; Single-pass membrane protein; Periplasmic side.

Q&A

What is the relationship between lipases and their chaperones in recombinant expression systems?

Lipases, particularly those from bacterial sources like Ralstonia sp. and Burkholderia species, often require specific chaperones for proper folding and activation. In recombinant expression systems, the lipase-encoding gene (e.g., lipA) and its corresponding chaperone-encoding gene (e.g., lipB) need to be co-expressed to produce functional lipase enzymes. The chaperone assists in proper folding of the lipase, ensuring it achieves its catalytically active conformation. Research indicates that optimal formation of functional lipase requires the lipase and chaperone in specific ratios, typically 1:1 for forming the lipase:chaperone complex . Without sufficient chaperone, recombinant lipases often form inactive inclusion bodies despite high expression levels.

What are the primary challenges in expressing functional recombinant lipases in E. coli?

Expression of functional lipases in E. coli presents several challenges:

  • Unequal expression levels of lipase and chaperone (typically lipase overexpression with insufficient chaperone production)

  • Formation of inclusion bodies leading to inactive enzyme

  • Inefficient in vivo folding requiring additional refolding procedures

  • Limited secretion of functional lipase into the culture medium

  • Maintaining optimal conditions for lipase stability and activity

Studies show that in standard single expression cassette plasmid systems, only 1-3% of expressed lipase becomes activated in vivo, despite the lipase accounting for up to 40% of total cellular protein . This inefficiency stems primarily from insufficient chaperone production, which is often less than 1% of total cellular protein in typical expression systems.

How does the ratio of lipase to chaperone affect the production of functional enzyme?

The ratio of lipase to chaperone is critical for optimal functional enzyme production. Research demonstrates that the optimal ratio for refolding is 1:1 for forming the lipase:chaperone complex. In standard expression systems (e.g., pELipAB in E. coli BL21), the lipase typically accounts for approximately 40% of total cellular protein, while the chaperone represents less than 1%, creating a significant imbalance .

In vitro refolding studies show that using an optimized lipase-to-chaperone ratio of 1:10 can increase functional lipase activity by approximately 4-fold (650 U/mg lipase protein) compared to lipase without refolding (151 U/mg) . This indicates that sufficient chaperone availability is essential for maximizing the proportion of expressed lipase that achieves functional conformation.

What are the main expression system designs for producing functional recombinant lipases?

Based on current research, three main expression system designs have been developed:

  • Single expression cassette plasmid systems: Both lipase and chaperone genes are expressed from a single plasmid (e.g., pELipAB), typically resulting in unbalanced expression with insufficient chaperone production.

  • Two-plasmid co-expression systems: The lipase gene is carried on one plasmid while the chaperone gene is on a separate plasmid (e.g., E. coli BL21/pELipAB + pELipB1), allowing for independent optimization of expression levels.

  • Dual expression cassette plasmid systems: Both genes are on the same plasmid but under separate expression control (e.g., BL21/pELipAB-LipB1), enabling coordinated but potentially better-balanced expression.

Research shows that two-plasmid co-expression systems produce approximately 4 times more active lipase than single expression cassette systems, while dual expression cassette plasmid systems can achieve 19-29 times higher active lipase production .

How do two-plasmid co-expression systems compare to dual expression cassette plasmid systems for lipase production?

Comparative analysis reveals significant differences in performance between these expression strategies:

Expression system BL21/Whole cell lysate activityRelative activity (%)
pELipAB (single expression)107.3 ± 3.6 U/g100 ± 3.4
pELipAB + pELipB1 (two-plasmid)492.7 ± 3.1 U/g458.9 ± 2.9
pELipAB + pELipB3 (two-plasmid)440.3 ± 5.7 U/g410.2 ± 5.3

For dual expression cassette plasmid systems, the functional lipase yield can be up to 29-fold higher than single expression cassette systems . Furthermore, these systems show superior secretion capability, with 29-51 times higher secretion of active lipase into the culture medium compared to single expression systems.

What modifications can enhance the production of active lipase in recombinant expression systems?

Several modifications have been shown to enhance active lipase production:

  • Chaperone truncation: Using truncated versions of chaperones (e.g., LipB1 with 56-aa truncation or LipB3 with 26-aa truncation) can improve functional lipase production .

  • Medium supplementation: Adding supplements like Neptune oil, gum Arabic, Tween 80, and Triton X-100 can double the production and secretion of active lipase in dual expression cassette plasmid systems .

  • Secretion signal sequence optimization: Incorporating signal sequences like ompA can significantly enhance lipase secretion. In some cases, this approach has increased functional lipase production by up to 450-fold (18,000 U/g) compared to basic single expression systems (40 U/g) .

  • IPTG induction optimization: Careful titration of IPTG concentration and induction timing can help balance lipase and chaperone expression levels.

How do FIFO and LIFO protocols impact experimental efficiency in recombinant protein expression?

FIFO (First In, First Out) and LIFO (Last In, First Out) protocols represent different approaches to experimental design that can impact efficiency. In protein expression studies, these concepts can be applied to sample processing and resource allocation decisions.

Research indicates that FIFO protocols generally demonstrate higher efficiency under rational behavior conditions, but the efficiency gap between FIFO and LIFO protocols can decrease under certain behavioral conditions . In experimental settings where selectivity thresholds are important (such as choosing which protein variants to characterize further), laboratory studies show that subjects under LIFO conditions tend to be overselective compared to rational benchmarks .

What behavioral patterns emerge in FIFO vs. LIFO experimental protocols?

Laboratory experiments examining FIFO and LIFO protocols reveal several behavioral patterns that may impact research efficiency:

  • In FIFO protocols, behavior converges quickly to rational benchmarks.

  • In LIFO protocols, subjects consistently demonstrate overselectivity compared to rational benchmarks.

  • Strategic complementarities exist in LIFO setups, where if one researcher expects others to be overselective, the best response is to be overselective as well .

These behavioral patterns have implications for collaborative research environments. The efficiency implications vary depending on the specific model and context, but understanding these tendencies can help research teams design more effective protocols for resource sharing and experiment prioritization.

What are the comparative advantages of in vivo folding versus in vitro refolding for recombinant lipases?

The choice between in vivo folding and in vitro refolding represents a critical decision point in recombinant lipase production:

In vivo folding advantages:

  • Eliminates additional refolding steps, simplifying the production process

  • Reduces processing time and potential protein loss during refolding

  • Suitable for continuous production and scale-up

  • Can be enhanced through co-expression of chaperones

In vitro refolding advantages:

  • Allows precise control of refolding conditions

  • Can achieve higher specific activity through optimized refolding conditions

  • Enables adjustment of lipase:chaperone ratios to optimal levels

  • Useful for lipases that form inclusion bodies despite chaperone co-expression

What methodological approaches can optimize in vivo folding of recombinant lipases?

Several strategies can enhance in vivo folding efficiency:

  • Balanced expression of lipase and chaperone: Designing expression systems that produce appropriate ratios of lipase and chaperone proteins, typically achieved through dual expression cassette plasmid systems or two-plasmid co-expression systems .

  • Temperature optimization: Lower induction temperatures (e.g., 25°C instead of 37°C) can slow protein synthesis and allow more time for proper folding.

  • Induction optimization: Controlled induction using varied IPTG concentrations can help balance expression levels.

  • Medium additives: Surfactants and oils like Triton X-100, Tween 80, and Neptune oil can double the production of active lipase by potentially stabilizing the protein during folding .

  • Host strain selection: E. coli strains with different chaperone systems may provide improved folding environments.

Despite these optimizations, research indicates that only a small fraction of overexpressed lipase becomes properly folded into functional form in vivo, with the main portion remaining inactive in inclusion bodies . This highlights the ongoing challenge of achieving efficient in vivo folding for these complex enzymes.

What are the standard methods for quantifying lipase expression levels in recombinant systems?

Standard analytical methods for lipase expression quantification include:

  • SDS-PAGE with densitometry analysis: This approach allows estimation of the relative amount of lipase protein as a percentage of total cellular protein. Using software such as Dolphin 1-D, researchers can quantify that lipase may constitute 10-40% of total cellular protein depending on the expression system .

  • Western blotting: For more specific detection and quantification, especially when expression levels are low or multiple proteins of similar size are present.

  • Mass spectrometry: Provides precise identification and can be used for absolute quantification when combined with standard curves of purified protein.

  • Enzyme activity assays: While not directly measuring protein quantity, lipase activity assays using substrates like p-nitrophenyl palmitate provide functional quantification.

When analyzing expression systems, it's important to examine both the lipase and chaperone expression levels. For example, in some systems, lipase expression can reach 40% of total cellular protein while chaperone expression remains below 1% , creating an imbalance that impacts functional enzyme production.

How can researchers accurately determine the fraction of functionally active lipase in expression studies?

Determining the fraction of functionally active lipase requires a combination of analytical approaches:

  • Enzyme activity assays: Measuring the hydrolytic activity of the lipase using standard substrates provides direct quantification of functional enzyme. Results can be expressed as Units per gram of wet cell weight (U/g) or specific activity (U/mg protein) .

  • Comparison of total vs. soluble expression: By separately analyzing total cellular protein versus soluble fraction, researchers can determine what percentage of expressed lipase is in potentially active soluble form versus inactive inclusion bodies.

  • Purification yields: Tracking protein through purification steps can help quantify the proportion of expressed protein that can be recovered in active form.

  • In vitro refolding efficiency: Comparing activity before and after refolding provides insight into the proportion of protein that can achieve active conformation.

Research on recombinant lipase systems indicates that with standard single expression cassette systems, only 1-3% of expressed lipase becomes functionally active in vivo . Enhanced systems like dual expression cassette plasmids can significantly improve this ratio, but still leave substantial room for optimization.

How do different bacterial lipase subfamilies compare in terms of expression requirements and chaperone dependence?

Lipases from different bacterial subfamilies show varying expression characteristics and chaperone dependencies:

  • Subfamily I.1 and I.2 lipases (from Pseudomonas and Burkholderia species): These typically require specific chaperones for functional expression. They often show poor secretion in heterologous hosts like E. coli . The paper mentions that "The secretion of subfamily I.1 and I.2 lipases did not proceed properly in heterologous hosts."

  • Ralstonia lipases: Similar to subfamily I.1, these require specific chaperones like LipB for proper folding and activation .

  • Other bacterial lipases: Some lipases from other bacterial sources may show less stringent chaperone requirements and more efficient heterologous expression.

These differences necessitate tailored expression strategies depending on the lipase source. For subfamily I.1 and I.2 lipases, dual expression cassette plasmid systems have shown particular promise, with potential for "industrial-scale production of subfamily I.1 and I.2 lipases" .

What are the primary considerations when scaling up recombinant lipase production from laboratory to pilot scale?

Scaling up recombinant lipase production requires addressing several key considerations:

  • Expression system stability: Dual expression cassette plasmid systems have demonstrated superior performance for chaperone-dependent lipases and may be better candidates for scale-up than two-plasmid systems, which can be less stable over extended cultivation .

  • Secretion optimization: As noted in the research, "the functional lipase in the culture supernatant of the dual expression cassette plasmid systems E. coli BL21/pELipAB-LipB1 and pELipAB-LipB3 was 50.7 and 29.3 times as high as the functional lipase in the culture supernatant of the single expression cassette plasmid system" . This suggests these systems offer significant advantages for secreted production.

  • Medium composition optimization: Additives like Neptune oil, gum Arabic, Tween 80, and Triton X-100 that double lipase production in laboratory settings should be evaluated for cost-effectiveness and compatibility at larger scales .

  • Purification strategy: For non-secreted production, efficient extraction and purification protocols must be developed, potentially including in vitro refolding if necessary.

  • Activity preservation: Maintaining enzyme stability during downstream processing becomes increasingly important at larger scales.

The research concludes that "an improved dual expression cassette plasmid system E. coli could be potentially applied for industrial-scale production of subfamily I.1 and I.2 lipases" , suggesting this approach has the most promise for scale-up applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.