Recombinant Burkholderia mallei Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice, please inform us in advance and expect additional charges.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; BMA0458; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Burkholderia mallei (strain ATCC 23344)
Target Names
dsbB
Target Protein Sequence
MNNLTLSLRRERRLLVLLALVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFI GAGMASGAGVAVTEALIVLSAAAGVGTAARHLYVQLNPGFSCGFDALQPVVDSLPPARWL PGVFKVAGLCETVYPPIFGILLPGWALIAFVLIAVPVAVSLLRHRGRLR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: bma:BMA0458

STRING: 243160.BMA0458

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia mallei DsbB and what is its primary function?

Burkholderia mallei disulfide bond formation protein B (DsbB) is a membrane protein involved in the bacterial disulfide bond (DSB) formation system. DsbB functions as the primary oxidizing partner for DsbA, creating a functional redox relay that catalyzes the formation of disulfide bonds in secreted and membrane-associated proteins. In this system, DsbB is responsible for re-oxidizing DsbA after it donates its disulfide to substrate proteins, maintaining the catalytic cycle essential for proper protein folding within the bacterial periplasm . This oxidoreductase activity is crucial for the structural integrity and function of many bacterial virulence factors. The DsbB protein in B. mallei shows high conservation with homologs in related species, particularly B. pseudomallei, sharing significant sequence identity .

How does B. mallei DsbB differ from its homolog in B. pseudomallei?

While B. mallei DsbB shares extensive structural and functional similarities with its B. pseudomallei counterpart, there are important contextual differences related to the bacterial species themselves. B. mallei is a host-adapted clone of B. pseudomallei with a significantly smaller genome, yet both species share genes with approximately 99% identity at the nucleotide level . The DsbB proteins between these species maintain high conservation, reflecting their essential role in bacterial physiology. B. mallei is unique in the Burkholderia family because it requires an animal host to survive, primarily affecting equines, whereas B. pseudomallei can persist in soil and water environments independently . This host adaptation of B. mallei may influence the specific substrate interactions and regulatory mechanisms of its DsbB protein, though the core catalytic function remains conserved between species .

What are the optimal conditions for expressing and purifying recombinant B. mallei DsbB?

For optimal expression and purification of recombinant B. mallei DsbB, researchers should consider the following methodological approach:

  • Expression System: Due to its membrane protein nature, expression in E. coli systems containing specialized membrane protein overexpression elements (such as C41/C43 strains or those with regulated T7 expression systems) is recommended.

  • Construction: Incorporate a cleavable affinity tag (His6, for example) at either the N- or C-terminus to facilitate purification while allowing tag removal for functional studies.

  • Induction Conditions: Express at lower temperatures (16-20°C) with reduced inducer concentrations to minimize inclusion body formation and promote proper membrane insertion.

  • Membrane Extraction: Utilize a two-step solubilization process with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to extract the protein from membranes while maintaining native folding.

  • Purification: Employ immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to achieve high purity.

  • Storage: Maintain in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

The purified protein should be validated for proper folding and activity through functional assays measuring its ability to oxidize DsbA or through direct redox state analysis of its catalytic cysteine residues.

How can researchers assess the functional activity of recombinant B. mallei DsbB in vitro?

Researchers can evaluate the functional activity of recombinant B. mallei DsbB through several complementary approaches:

  • DsbA Oxidation Assay: Measuring the ability of DsbB to re-oxidize reduced DsbA using fluorescent or colorimetric substrates that detect the redox state of DsbA's active site cysteines. This can be monitored by changes in fluorescence or absorbance over time.

  • Quinone Reduction Assay: Monitoring the reduction of ubiquinone analogues (such as ubiquinone-1 or ubiquinone-5) by DsbB, which couples electron transfer from DsbA to the quinone pool.

  • Coupled Enzyme Assays: Utilizing a system where DsbA oxidizes a substrate protein with measurable activity (such as alkaline phosphatase or RNase) that depends on disulfide bond formation, with DsbB maintaining DsbA in the active oxidized state.

  • Membrane Reconstitution: Incorporating purified DsbB into proteoliposomes with quinones to reconstitute the complete electron transfer pathway, allowing for more physiologically relevant activity measurements.

  • Surface Plasmon Resonance (SPR): Directly measuring the binding kinetics between immobilized DsbB and DsbA to evaluate their interaction properties.

These functional assays should be performed under controlled redox conditions, with careful attention to buffer composition, pH, and temperature that mimic the physiological environment of the bacterial periplasm .

What methods are used to study the interaction between B. mallei DsbB and DsbA?

Multiple complementary techniques can be employed to characterize the interaction between B. mallei DsbB and DsbA:

  • Co-crystallization and X-ray Crystallography: Crystal structures of DsbB-derived peptides complexed with DsbA provide direct visualization of interaction interfaces at atomic resolution. This approach has successfully elucidated key molecular details of the DsbB-DsbA interaction in related systems like B. pseudomallei .

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry analysis can identify proximity-based interactions between specific residues of DsbB and DsbA.

  • Site-Directed Mutagenesis: Systematic mutation of residues in both proteins coupled with functional assays can identify critical interaction points and distinguish between residues involved in binding versus catalysis.

  • Isothermal Titration Calorimetry (ITC): This technique provides thermodynamic parameters (ΔH, ΔS, and KD) of the DsbB-DsbA interaction under various conditions.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For analyzing structural changes and dynamics of the interaction, particularly useful for detecting conformational shifts upon binding.

  • Biochemical Redox Assays: Monitoring electron transfer between the proteins using techniques that detect changes in the redox state of critical cysteine residues.

Research with B. pseudomallei has demonstrated that DsbB forms a functional redox relay with DsbA, which is likely conserved in B. mallei given their high genetic similarity . These interaction studies are crucial for understanding the mechanism of disulfide bond formation and designing potential inhibitors targeting this essential pathway.

How does DsbB contribute to B. mallei virulence mechanisms?

DsbB plays a critical role in B. mallei virulence through its essential function in the disulfide bond formation pathway. Based on studies in the closely related B. pseudomallei, DsbB's contribution to virulence can be understood through several mechanisms:

  • Virulence Factor Maturation: DsbB ensures the proper folding and stability of numerous secreted virulence factors that require disulfide bonds for their structural integrity and function, including toxins, adhesins, and components of secretion systems.

  • Motility Regulation: DsbB affects bacterial motility, as demonstrated in B. pseudomallei where dsbB deletion strains showed significantly reduced motility in some clinical isolates. For example, B. pseudomallei K96243 ΔdsbB and 576 ΔdsbB exhibited mean zones of motility reduced from 56 mm to 38 mm and from 49 mm to 33 mm, respectively, compared to wild-type strains .

  • Secretion System Function: The type III and type VI secretion systems, critical for bacterial invasion and intracellular survival, contain multiple components that require disulfide bonds for proper assembly and function, making them dependent on the DsbB-DsbA pathway.

  • Stress Resistance: The DsbB-DsbA system contributes to bacterial resistance against oxidative stress encountered during host immune responses, thereby enhancing bacterial survival within host cells.

  • Host-Pathogen Interaction: Properly folded surface proteins facilitated by DsbB activity are essential for bacterial adhesion, invasion, and modulation of host immune responses.

Genetic evidence strongly supports DsbB's importance in virulence, as dsbB deletion strains of B. pseudomallei were significantly attenuated in a BALB/c mouse model of infection, regardless of their in vitro virulence phenotypes . This suggests that DsbB represents a potential target for antimicrobial development against B. mallei infections.

How conserved is DsbB across different clinical isolates of Burkholderia species?

DsbB displays remarkable conservation across different clinical isolates of Burkholderia species, indicating its fundamental importance to bacterial physiology and virulence. Genomic analysis of 431 clinical isolates of B. pseudomallei from the Darwin Prospective Melioidosis Study revealed that:

  • Core Genome Component: Both dsbB and dsbA are contained in the core genome of B. pseudomallei, with all analyzed isolates containing complete sequences for these genes .

  • High Sequence Conservation: The vast majority of B. pseudomallei isolates possess dsbB sequences identical to the reference strain K96243, with minimal sequence variation observed across the clinical isolate collection .

  • Cross-Species Conservation: B. mallei and B. pseudomallei share genes with approximately 99% identity at the nucleotide level, suggesting similar conservation patterns for dsbB between these closely related species .

This high degree of conservation stands in contrast to the greater genomic diversity observed in many other virulence-associated genes and supports the essential nature of DsbB function. The conservation extends beyond sequence to function, as demonstrated by the ability of DsbB to form functional redox relays with DsbA across different Burkholderia species .

The conservation of DsbB across clinical isolates suggests that it represents a stable target for antimicrobial development, as resistance-conferring mutations might be constrained by the essential nature of DsbB's function in bacterial physiology.

What strategies can be used to develop inhibitors targeting B. mallei DsbB?

Development of inhibitors targeting B. mallei DsbB can follow several strategic approaches:

  • Structure-Based Drug Design: Using the crystal structure of DsbB-DsbA complexes as a template for rational design of molecules that interfere with their interaction. Research has provided high-resolution structural data of the active site and DsbB engagement region that can guide such efforts .

  • Peptidomimetic Inhibitors: Designing peptides or peptidomimetics based on the interaction interface between DsbB and DsbA, which can compete with the natural binding and disrupt the redox relay.

  • Active Site-Directed Compounds: Developing compounds that target the redox-active cysteine residues in DsbB, potentially forming stable adducts that prevent catalytic function.

  • Quinone Binding Site Inhibitors: Creating molecules that compete with ubiquinone for binding to DsbB, thereby blocking the electron transfer pathway essential for DsbB's oxidizing function.

  • Allosteric Inhibitors: Identifying compounds that bind to sites distinct from the active site but induce conformational changes that impair DsbB function or its interaction with DsbA.

  • Natural Product Screening: Evaluating libraries of natural products for compounds that selectively inhibit DsbB activity in biochemical assays.

The development of DsbB inhibitors represents a promising approach for novel antimicrobials, particularly given DsbB's established role in virulence and its high conservation across clinical isolates of Burkholderia species . Additionally, the absence of a mammalian homolog reduces the risk of host toxicity for compounds targeting this bacterial system.

How can recombinant B. mallei DsbB be utilized in vaccine development strategies?

Recombinant B. mallei DsbB offers several potential applications in vaccine development strategies:

  • Subunit Vaccine Component: As a highly conserved protein across Burkholderia species, recombinant DsbB could serve as an antigen in subunit vaccine formulations, potentially providing cross-protection against both B. mallei and B. pseudomallei infections.

  • Adjuvant Carrier Protein: DsbB could be engineered as a carrier protein for weakly immunogenic antigens, potentially enhancing their presentation to the immune system.

  • Live Attenuated Vaccine Platform: ΔdsbB strains of B. mallei, similar to the attenuated ΔdsbB strains demonstrated in B. pseudomallei, could potentially serve as live attenuated vaccine candidates that maintain immunogenicity while exhibiting reduced virulence .

  • Immunomodulatory Effects Assessment: Studies with recombinant DsbB can help determine its immunomodulatory properties, which might influence vaccine design either as a component or as a co-administered agent.

  • Epitope Mapping: Systematic analysis of B. mallei DsbB can identify immunodominant epitopes that might serve as the basis for epitope-based vaccine designs, potentially focusing immune responses on conserved, functional regions of the protein.

What are the challenges in translating in vitro findings about B. mallei DsbB to in vivo applications?

Translating in vitro findings about B. mallei DsbB to in vivo applications faces several significant challenges:

  • Strain-Dependent Phenotypic Variation: Research with B. pseudomallei has demonstrated that dsbB deletion effects can vary significantly between different clinical isolates, with some strains showing dramatic motility defects while others remain unaffected . This variability complicates the prediction of in vivo outcomes based on in vitro studies.

  • Complex Host-Pathogen Interactions: The intracellular lifestyle of B. mallei involves complex interactions with host cells that may not be fully recapitulated in simplified in vitro systems, potentially masking or altering the importance of DsbB-dependent processes.

  • Redox Environment Differences: The redox environment in vivo differs significantly from in vitro conditions, potentially affecting the activity and importance of the DsbB-DsbA redox relay in different host compartments or infection stages.

  • Compensatory Mechanisms: Bacteria may activate alternative pathways in vivo to compensate for DsbB deficiency, potentially leading to differences between in vitro phenotypes and in vivo outcomes.

  • Target Accessibility: For therapeutic applications targeting DsbB, the intracellular location of B. mallei presents challenges for drug delivery, requiring compounds to penetrate both host cell membranes and bacterial membranes.

Despite these challenges, animal model studies with B. pseudomallei have demonstrated that dsbB deletion strains are attenuated in vivo regardless of their in vitro phenotypes, suggesting that DsbB function remains essential during actual infection . This underscores the importance of complementing in vitro studies with appropriate animal models to fully understand the role of DsbB in pathogenesis and its potential as a therapeutic target.

How does B. mallei DsbB compare to homologous proteins in other bacterial pathogens?

B. mallei DsbB shares functional similarities with homologous proteins across bacterial pathogens, but with important structural and evolutionary distinctions:

Bacterial SpeciesSequence Identity to B. mallei DsbBKey Structural/Functional DifferencesSignificance
B. pseudomallei~99%Minimal differences due to close evolutionary relationshipFunctional studies in B. pseudomallei likely directly applicable to B. mallei
B. cepacia~88%Moderate conservation with potential variation in substrate specificityMay share core mechanisms but differ in regulation and specific interactions
P. aeruginosa~44%More significant divergence but conservation of catalytic motifsProvides comparative model for understanding DsbB function across distantly related species
E. coli<40% (estimated)Different membrane topology and quinone specificityWell-studied prototype for DsbB function but with notable mechanistic differences

The study of DsbB across these species provides evolutionary insights into the adaptation of redox systems in different bacterial contexts while highlighting conserved mechanisms that might represent broadly applicable therapeutic targets .

What is known about the evolutionary history of DsbB in the Burkholderiaceae family?

The evolutionary history of DsbB in the Burkholderiaceae family reflects both conservation of essential function and adaptation to specific ecological niches:

  • Phylogenetic Position: Burkholderia species form a monophyletic group within the Burkholderiales order of the Betaproteobacteria, with three distinct monophyletic clusters identified within the genus. B. mallei and B. pseudomallei belong to the same clade within these clusters .

  • Host Adaptation: B. mallei represents a host-adapted clone of B. pseudomallei with a reduced genome but retention of the dsbB gene, indicating its essential function even during evolutionary genome reduction associated with host specialization .

  • Conservation Patterns: The dsbB gene is part of the core genome in B. pseudomallei, with analysis of 431 clinical isolates showing high sequence conservation. This pattern likely extends to other members of the Burkholderiaceae family, reflecting the essential nature of disulfide bond formation .

  • Functional Conservation: Despite varying degrees of sequence divergence across the family, the fundamental function of DsbB in re-oxidizing DsbA appears conserved, with maintenance of critical catalytic residues and interaction interfaces.

The high conservation of DsbB across clinical isolates and related species suggests strong selective pressure to maintain its function, highlighting its importance in bacterial physiology and potential as a broadly effective therapeutic target against multiple members of the Burkholderiaceae family .

What are the current gaps in our understanding of B. mallei DsbB function?

Despite advances in understanding bacterial disulfide bond formation systems, several critical knowledge gaps remain regarding B. mallei DsbB:

  • Species-Specific Substrate Repertoire: While the general function of DsbB in oxidizing DsbA is established, the specific repertoire of B. mallei virulence factors dependent on this pathway remains incompletely characterized, limiting our understanding of how DsbB contributes to pathogenesis in this specific organism.

  • Structural Determinants of Specificity: High-resolution structural information specific to B. mallei DsbB and its interaction with B. mallei DsbA is lacking, creating uncertainty about the precise molecular determinants of their interaction and potential species-specific features.

  • Regulation During Infection: The regulation of dsbB expression and DsbB activity during different stages of B. mallei infection remains poorly understood, including potential responses to changing host environments.

  • Alternative Electron Acceptors: While the canonical pathway involves quinones as electron acceptors, the potential for DsbB to utilize alternative electron acceptors under different environmental conditions (particularly anaerobic environments) remains unexplored.

  • Inhibitor Binding Sites: Detailed mapping of potential inhibitor binding sites on B. mallei DsbB, beyond the primary DsbA interaction interface, could reveal opportunities for therapeutic intervention that have not yet been exploited.

Addressing these knowledge gaps would enhance our understanding of B. mallei pathogenesis and potentially reveal new approaches for intervention against this significant pathogen.

What novel experimental approaches could advance research on B. mallei DsbB?

Several innovative experimental approaches could significantly advance our understanding of B. mallei DsbB:

  • Cryo-Electron Microscopy (Cryo-EM): Applying cryo-EM to visualize the full-length B. mallei DsbB in a membrane environment, potentially in complex with DsbA, would provide insights into the native structure and conformational dynamics not accessible through crystallography of peptide fragments.

  • Time-Resolved Spectroscopy: Implementing ultra-fast spectroscopic techniques to track electron transfer events between DsbA, DsbB, and quinones in real-time could elucidate the kinetic and thermodynamic parameters of this crucial redox relay.

  • Proteome-Wide Disulfide Bond Mapping: Developing methods to systematically identify all proteins with DsbB-dependent disulfide bonds in B. mallei using mass spectrometry-based approaches would comprehensively define the DsbB substrate repertoire.

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET): Utilizing smFRET to observe DsbB-DsbA interactions at the single-molecule level could reveal heterogeneity and dynamic aspects of this interaction not apparent in ensemble measurements.

  • In Vivo Redox Imaging: Developing fluorescent reporters to visualize the activity of the DsbB-DsbA system within living bacteria during infection would provide unprecedented insights into the spatiotemporal dynamics of disulfide bond formation.

  • Genetic Interaction Mapping: Conducting systematic genetic interaction studies (e.g., synthetic lethality screens) with dsbB mutations could identify compensatory or synergistic pathways relevant to virulence and potential combination therapeutic targets.

These approaches would complement existing research methodologies and potentially overcome current limitations in studying this membrane-bound oxidoreductase system in its native context.

How might targeting DsbB inform broader antimicrobial development strategies?

Targeting DsbB represents a paradigm for antimicrobial development with several broader implications:

  • Virulence-Targeting Approach: Rather than directly killing bacteria, DsbB inhibitors would primarily disrupt virulence factor maturation, potentially reducing selection pressure for resistance while still enabling host clearance of the pathogen. This approach aligns with the broader antimicrobial stewardship goal of developing non-bactericidal alternatives to conventional antibiotics.

  • Multi-Pathogen Applications: The conservation of DsbB across multiple pathogens suggests that inhibitors could potentially have broad-spectrum activity against several Gram-negative bacteria beyond just Burkholderia species, addressing the need for new therapeutics against multiple priority pathogens .

  • Combination Therapy Models: DsbB inhibitors could serve as adjuvants to conventional antibiotics, potentially enhancing their efficacy by compromising bacterial defense mechanisms dependent on properly folded disulfide-containing proteins.

  • Target Validation Framework: The methodologies developed for validating DsbB as a therapeutic target (including genetic, biochemical, and structural approaches) provide a template for evaluating other non-conventional bacterial targets involved in virulence rather than essential growth functions.

  • Host-Microbiome Considerations: Unlike broad-spectrum antibiotics that disrupt commensal bacteria, DsbB inhibitors might potentially be designed with selectivity for pathogenic species based on subtle structural differences in their disulfide bond formation systems, supporting antimicrobial approaches that preserve beneficial microbiota.

Research on DsbB inhibitors thus contributes not only to specific countermeasures against B. mallei but also to the broader paradigm shift toward targeting bacterial virulence and pathogenicity mechanisms rather than growth, potentially addressing key challenges in current antimicrobial therapy including resistance and collateral damage to the microbiome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.