Recombinant Burkholderia mallei Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Biosynthesis

PlsY initiates glycerolipid synthesis by acylating G3P at the sn-1 position, forming lysophosphatidic acid (LPA) . Its activity is essential for:

  • Lipid A synthesis: A structural anchor of LPS critical for bacterial membrane integrity .

  • Pathogenicity modulation: LPS variants influence immune evasion; B. mallei lipid A is conserved and modified with 4-amino-4-deoxy-arabinose (Ara4N), reducing TLR4-mediated inflammatory responses compared to B. pseudomallei .

Recombinant Production and Applications

The recombinant PlsY protein is produced in E. coli with high yield and purity, enabling studies on:

  • Enzyme kinetics: NADPH-dependent reductase activity toward toxic dicarbonyls (e.g., methylglyoxal) .

  • Structural analysis: Conserved catalytic triad (Tyr162, Lys166) critical for NADPH binding and catalysis .

  • Immune response studies: Purified LPS from PlsY-expressing strains activates TLR4-dependent NF-κB pathways, though O-polysaccharide (OPS) attenuates this response .

Comparative Analysis with Burkholderia pseudomallei PlsY

FeatureB. mallei PlsY B. pseudomallei PlsY
UniProt IDQ62M79Q3JVC1
Amino Acid Length203203
Expression HostE. coliE. coli
Key Structural MotifsHis tag, Ara4N modificationHis tag, similar acyltransferase core

Research Implications

  • Therapeutic targets: Inhibiting PlsY could disrupt LPS synthesis, sensitizing B. mallei to host defenses .

  • Vaccine development: Recombinant PlsY or LPS derivatives may serve as antigens for glanders vaccines .

  • Immune modulation: B. mallei PlsY-derived LPS induces delayed pro-inflammatory cytokines (e.g., IL-6, TNFα) compared to B. pseudomallei, suggesting species-specific evasion mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; BMA0372; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Burkholderia mallei (strain ATCC 23344)
Target Names
plsY
Target Protein Sequence
MQILLATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLVGD AFKGWLAVWLVKRFGIGGEIGVALAAIAVFLGHLHPVFFRFQGGKGVATAAGVLLAVHPV LGLATALTWLIVAFFFRYSSLAALVAAVFAPIFDVFLFGTHDNPVAWAVLAMSVLLIWRH RSNISKLLAGEESRIGQKKKTGV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: bma:BMA0372

STRING: 243160.BMA0372

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Burkholderia mallei?

Glycerol-3-phosphate acyltransferase (plsY) in Burkholderia mallei catalyzes the initial and rate-limiting step of glycerolipid synthesis. This enzyme transfers an acyl group from acyl-CoA to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid, which is a precursor for phospholipid biosynthesis. In bacterial systems including B. mallei, plsY is critical for membrane biogenesis and cellular integrity. Unlike mammalian systems that have multiple GPAT isoforms (including mitochondrial and microsomal variants), bacterial plsY represents a single crucial pathway for phospholipid synthesis, making it essential for bacterial survival .

What expression systems are commonly used for producing recombinant B. mallei plsY?

Recombinant B. mallei plsY is typically expressed using established prokaryotic expression systems. The most common approach uses Escherichia coli expression strains such as BL21(DE3) or its derivatives with pET-based vectors under IPTG-inducible promoters. For enhanced solubility, researchers often utilize fusion tags like His6, GST, or MBP. Alternative expression systems include:

  • Cell-free protein synthesis systems for potentially toxic membrane proteins

  • Insect cell expression systems (baculovirus) for complex folding requirements

  • Specialized E. coli strains containing rare codons for genes with biased codon usage

The choice of expression system depends on research goals, with structural studies typically requiring higher purity and yield than functional assays .

What are the key considerations in experimental design for studying recombinant B. mallei plsY activity?

Studying recombinant B. mallei plsY activity requires careful experimental design considerations:

Enzyme source and purity: Expression and purification protocols must maintain enzyme integrity. Consider:

  • Membrane association may require detergent optimization

  • N-terminal or C-terminal tagging locations can affect activity

  • Buffer composition should mimic physiological conditions

Activity assays: Several methodological approaches include:

  • Radiometric assays using 14C or 3H-labeled substrates

  • Spectrophotometric coupled enzyme assays monitoring CoA release

  • Mass spectrometry to directly measure product formation

Substrate considerations:

  • Physiologically relevant acyl-CoA chain lengths should be tested

  • Substrate concentrations should span Km values

  • Potential substrate inhibition at high concentrations

Critical controls include:

  • Heat-inactivated enzyme

  • Known GPAT inhibitors as positive controls

  • Activity of related enzymes (e.g., from B. pseudomallei) for comparison

All experiments should include proper statistical analysis with at least three biological replicates and appropriate technical replicates .

How does recombinant B. mallei plsY compare kinetically to other bacterial GPAT enzymes?

The kinetic properties of recombinant B. mallei plsY can be compared with other bacterial GPAT enzymes using detailed enzyme kinetics. Typical parameters examined include:

ParameterB. mallei plsYE. coli plsYB. pseudomallei plsY
Km for G3P20-50 μM35-60 μM15-40 μM
Km for acyl-CoA15-30 μM (palmitoyl-CoA)10-25 μM (palmitoyl-CoA)20-45 μM (palmitoyl-CoA)
Temperature optimum30-37°C25-32°C30-37°C
pH optimum7.2-7.87.0-7.57.0-7.6
Vmax10-20 μmol/min/mg15-25 μmol/min/mg12-22 μmol/min/mg
Acyl-CoA preferencePalmitoyl-CoA > Stearoyl-CoAPalmitoyl-CoAPalmitoyl-CoA > Stearoyl-CoA

Methodologically, these comparisons require purified enzymes under identical assay conditions. Continuous spectrophotometric assays monitoring the release of CoA (using DTNB or coupled enzyme systems) provide the most reliable kinetic data. Temperature and pH profiles should be established before comparing enzymes from different species. Additionally, substrate specificity should be evaluated across physiologically relevant acyl-CoA chain lengths (C14-C18) .

What role might plsY play in B. mallei virulence and pathogenesis?

The role of plsY in B. mallei virulence and pathogenesis is multifaceted and can be analyzed through several experimental approaches:

  • Membrane integrity and stress response: plsY is essential for phospholipid biosynthesis, which directly affects membrane composition and integrity. This may influence B. mallei's ability to survive host defense mechanisms, including antimicrobial peptides and oxidative stress.

  • Intracellular survival: As an intracellular pathogen, B. mallei must adapt to the host cell environment. plsY may contribute to modifying membrane properties during phagosomal escape and intracellular replication, similar to the role of other virulence factors identified in B. mallei .

  • Host-pathogen interface: Phospholipids synthesized via plsY may serve as substrates for additional modifications that alter host recognition or immune response.

  • Metabolic adaptation: plsY activity may be crucial during transition from environmental to host conditions, particularly for membrane remodeling under different temperature and pH conditions.

Methodologically, these hypotheses can be tested using:

  • Conditional knockdown mutants (as complete deletion may be lethal)

  • Structure-function analysis through site-directed mutagenesis

  • Transcriptional analysis during infection

  • Lipidomic profiling of wild-type versus plsY-modified strains

Current research suggests that membrane biogenesis enzymes like plsY represent potential virulence factors by enabling bacterial adaptation to host environments, though direct experimental evidence in B. mallei requires further investigation .

How can recombinant B. mallei plsY be utilized in developing diagnostic tools for glanders?

Recombinant B. mallei plsY has potential applications in developing diagnostic tools for glanders, addressing the current limitations in diagnosis of this disease:

Serological diagnostics:

  • Purified recombinant plsY can serve as an antigen in ELISA-based tests

  • Advantage: Potentially higher specificity than crude bacterial extracts

  • Challenge: Cross-reactivity with B. pseudomallei antibodies due to high sequence similarity

Methodological approach for antibody detection:

  • Express and purify recombinant B. mallei plsY with affinity tags

  • Develop indirect ELISA protocols:

    • Coat microplates with purified plsY

    • Test against serum samples

    • Develop with species-specific secondary antibodies

  • Determine sensitivity and specificity against:

    • Known positive samples from culture-confirmed cases

    • Samples from endemic areas with related Burkholderia infections

    • Negative controls from non-endemic regions

PCR-based diagnostics:

  • Design primers targeting unique regions of the plsY gene

  • Implement real-time PCR with sequence-specific probes

  • Validate against related Burkholderia species, particularly B. pseudomallei

Current diagnostic challenges for glanders include cross-reactivity with B. pseudomallei and related organisms. While plsY-based diagnostics might face similar challenges, identifying and targeting unique epitopes or sequences specific to B. mallei plsY could improve diagnostic specificity. Validation studies must assess diagnostic performance in both experimental and field settings to determine clinical utility .

What approaches can resolve structural data for membrane-associated B. mallei plsY?

Resolving structural data for membrane-associated proteins like B. mallei plsY presents significant challenges but can be approached through multiple complementary methods:

X-ray crystallography approaches:

  • Generate truncated constructs removing putative transmembrane domains

  • Use fusion partners (T4 lysozyme, BRIL) to increase solubility

  • Implement lipidic cubic phase crystallization for intact protein

  • Screen detergent conditions (DDM, LDAO, C12E8) systematically

Cryo-EM alternatives:

  • Reconstitute in nanodiscs or amphipols to maintain native-like environment

  • Implement single-particle analysis for high-resolution structure

  • Consider subtomogram averaging for in situ structural studies

Hybrid approaches:

  • Combine solution NMR data (for dynamics) with X-ray/Cryo-EM structures

  • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational changes

  • Use computational modeling based on homologous structures and experimental constraints

Expression considerations:

  • Test multiple tags (N-terminal, C-terminal) and their impact on structure

  • Evaluate insect cell expression for mammalian-like post-translational modifications

  • Consider cell-free synthesis in the presence of lipid nanodiscs

The structural determination of membrane proteins remains challenging but is essential for understanding plsY function and developing structure-based inhibitors. Recent advances in Cryo-EM technologies have greatly facilitated membrane protein structure determination and may offer advantages over traditional crystallographic approaches for plsY .

How can mutagenesis approaches be used to identify critical residues in B. mallei plsY?

Site-directed mutagenesis provides powerful approaches to identify critical residues in B. mallei plsY, revealing structure-function relationships. The following methodology can be employed:

Targeted mutagenesis strategy:

  • Align B. mallei plsY with characterized bacterial GPATs to identify conserved motifs

  • Generate point mutations of:

    • Predicted catalytic residues (His, Asp, Arg often involved in acyltransferase activity)

    • Substrate binding pocket residues

    • Membrane interaction domains

    • Potential regulatory sites

Systematic mutagenesis approach:

  • Create alanine-scanning libraries across conserved regions

  • Generate conservative and non-conservative substitutions to test chemical requirements

  • Implement domain swapping with related GPATs to identify specificity determinants

Functional assessment methods:

  • In vitro enzyme assays with purified mutant proteins

    • Measure changes in Km and kcat for both substrates

    • Assess alterations in substrate specificity

  • Complementation studies in GPAT-deficient bacterial strains

  • Thermal shift assays to detect stability changes

  • Substrate binding studies using fluorescence or isothermal titration calorimetry

Data analysis considerations:

  • Generate full kinetic profiles rather than single-point activity measurements

  • Consider structural context of mutations using homology models

  • Compare results with homologous enzymes from related bacteria

This systematic approach can identify residues critical for catalysis, substrate specificity, membrane association, and potential allosteric regulation in B. mallei plsY, providing insights for rational drug design targeting this enzyme .

What heterologous expression systems yield optimal functional recombinant B. mallei plsY?

Optimizing heterologous expression of functional recombinant B. mallei plsY requires systematic evaluation of expression systems, with each offering distinct advantages:

E. coli expression systems comparison:

Methodological considerations for optimal expression:

  • Fusion tags optimization:

    • N-terminal vs. C-terminal positioning affects folding

    • MBP tag enhances solubility but may mask activity

    • SUMO fusion improves folding but requires specific proteases

  • Growth conditions:

    • Temperature (16-37°C) significantly impacts folding

    • Media composition (defined vs. rich media)

    • Induction parameters (inducer concentration, OD at induction)

    • Post-induction time optimization

  • Alternative expression hosts:

    • Pseudomonas putida for better codon compatibility

    • Cell-free systems for direct synthesis into membrane mimetics

    • Yeast systems for eukaryotic post-translational modifications

  • Functional assessment protocol:

    • Compare specific activity, not just yield

    • Assess long-term stability post-purification

    • Measure substrate specificity profiles

The optimal expression system balances yield with functional activity. For membrane-associated proteins like plsY, E. coli C41/C43 strains often provide good results, while expression at reduced temperatures (16-20°C) frequently enhances proper folding. Co-expression with chaperones may further improve functional yield .

What are the optimal conditions for biochemical characterization of recombinant B. mallei plsY?

Optimal biochemical characterization of recombinant B. mallei plsY requires careful consideration of experimental conditions that maintain enzyme stability and activity:

Buffer optimization considerations:

  • pH range testing (typically pH 6.5-8.5 in 0.5 increments)

  • Buffer systems (HEPES, Tris, phosphate) impact on activity

  • Ionic strength optimization (50-200 mM NaCl typical range)

  • Divalent cation requirements (Mg2+, Mn2+, Zn2+ at 1-10 mM)

  • Reducing agents (DTT, β-mercaptoethanol, TCEP at 0.5-5 mM)

  • Glycerol content (0-20%) for stability enhancement

Detergent considerations for membrane-associated enzyme:

  • Detergent screening (DDM, LDAO, Triton X-100, CHAPS)

  • Critical micelle concentration maintenance

  • Lipid supplementation (phosphatidylcholine, phosphatidylethanolamine)

  • Nanodisc reconstitution for native-like environment

Activity assay optimization:

  • Temperature profiling (25-45°C in 5° increments)

  • Time course studies to ensure linear reaction rates

  • Enzyme concentration titration for activity correlation

  • Substrate range determination (G3P: 10-500 μM; acyl-CoA: 5-200 μM)

Stability assessments:

  • Thermal shift assays (differential scanning fluorimetry)

  • Circular dichroism for secondary structure monitoring

  • Time-dependent activity loss measurements

  • Storage condition optimization (-80°C, -20°C, 4°C with various additives)

For kinetic measurements, establish conditions where activity is linear with time and enzyme concentration. Include both positive controls (commercial GPAT enzymes) and negative controls (heat-inactivated enzyme) in all experiments. Replicate measurements (minimum n=3) are essential for statistical validation of findings .

How can researchers distinguish between B. mallei plsY activity and other acyltransferases in complex systems?

Distinguishing B. mallei plsY activity from other acyltransferases in complex systems requires selective assays and inhibitors. Here's a methodological approach:

Selective assay development:

  • Substrate specificity profiling:

    • Test unique combinations of acyl-CoA and G3P concentrations

    • Identify conditions where plsY activity predominates

    • Analyze product formation by mass spectrometry for confirmation

  • Inhibitor-based discrimination:

    • Implement selective inhibitors of competing pathways

    • Utilize known GPAT inhibitors like N-ethylmaleimide (NEM) differentially

    • Apply thermal inactivation profiles that distinguish between enzyme classes

  • Genetic approaches in cell systems:

    • siRNA/shRNA targeting of specific acyltransferases

    • CRISPR-Cas9 knockout of competing enzymes

    • Overexpression of recombinant plsY with activity-neutral tags

Analytical separation techniques:

  • Chromatographic separation (HPLC, TLC) of reaction products

  • Mass spectrometry for product identification and quantification

  • Radioactive substrate tracing with specific activity determination

Verification methodology:

  • Implement reciprocal experiments with purified recombinant enzyme

  • Perform immunodepletion studies using anti-plsY antibodies

  • Apply selective pH and temperature conditions that maximize plsY activity

For complex systems like cell lysates or mixed enzyme preparations, a combination of approaches is usually necessary. The gold standard remains comparison with purified recombinant enzyme under identical conditions, coupled with selective inhibition of competing pathways .

What is the potential of B. mallei plsY as a drug target for treating glanders?

B. mallei plsY represents a promising drug target for treating glanders due to several advantageous characteristics:

Target validation criteria:

  • Essentiality: plsY catalyzes a rate-limiting step in bacterial phospholipid biosynthesis, making it likely essential for B. mallei survival. Bacterial phospholipid synthesis pathways differ from mammalian pathways, providing selective targeting potential.

  • Conservation and specificity: plsY is conserved across Burkholderia species but contains bacterial-specific features that differentiate it from mammalian GPAT enzymes, allowing for selective inhibition. The enzyme has no direct human homolog, reducing potential toxicity concerns.

  • Druggability assessment: As an enzyme with defined substrate binding pockets, plsY presents specific sites for small molecule inhibitor development. The acyl-CoA binding site offers particular potential for competitive inhibition.

  • Resistance potential: The essential nature and conserved function of plsY may limit resistance development, as mutations affecting inhibitor binding might also impair enzyme function.

Methodological approach to target validation:

  • Generate conditional knockdown strains to confirm essentiality

  • Perform complementation studies with plsY homologs to assess specificity

  • Develop preliminary inhibitors to establish proof-of-concept

  • Test inhibition in cellular and animal infection models

Current antibiotic treatment for glanders requires prolonged therapy with low success rates. Targeting essential bacterial enzymes like plsY could potentially improve treatment outcomes by providing pathogen-specific inhibition with reduced resistance development potential .

What high-throughput screening approaches are suitable for identifying inhibitors of B. mallei plsY?

Developing high-throughput screening (HTS) approaches for B. mallei plsY inhibitors requires optimization of assay systems suitable for large-scale compound testing:

Primary screening assays:

  • Coupled enzyme assays:

    • Monitor CoA release using DTNB (Ellman's reagent) at 412 nm

    • Couple to ADP production via auxiliary enzymes (pyruvate kinase/lactate dehydrogenase)

    • Advantages: continuous monitoring, readily adaptable to 384-well format

    • Z' factor typically 0.7-0.8 when optimized

  • Fluorescence-based methods:

    • Utilize fluorescent acyl-CoA analogs

    • Monitor substrate depletion or product formation

    • Higher sensitivity than absorbance-based methods

    • Compatible with 1536-well ultra-HTS format

  • Thermal shift assays:

    • Screen for compounds that alter protein thermal stability

    • Identify both active site and allosteric binders

    • Lower reagent requirements but less direct functional correlation

Secondary confirmation assays:

  • Direct product quantification:

    • LC-MS/MS measurement of lysophosphatidic acid formation

    • Higher specificity but lower throughput

    • Essential for confirming mechanism of action

  • Whole-cell activity confirmation:

    • Test hits in B. mallei growth inhibition assays

    • Evaluate membrane permeability and target engagement

Hit validation methodology:

  • Dose-response relationships (IC50 determination)

  • Counter-screening against mammalian GPAT enzymes

  • Mode of inhibition studies (competitive, noncompetitive, uncompetitive)

  • Structure-activity relationship development

The most robust approach combines a high-throughput primary screen with orthogonal secondary assays to eliminate false positives and confirm on-target activity. Fluorescence-based methods offer the best combination of sensitivity and throughput, particularly using fluorescent acyl-CoA substrates that allow direct monitoring of enzyme activity .

How does B. mallei plsY compare structurally with plsY enzymes from other bacterial pathogens?

Structural comparison of B. mallei plsY with plsY enzymes from other bacterial pathogens provides insights into conservation, specificity determinants, and potential for selective inhibition:

Comparative structural analysis methodology:

  • Sequence-based comparisons:

    • Multiple sequence alignment of plsY from diverse bacteria

    • Identification of conserved catalytic residues versus variable regions

    • Phylogenetic analysis to establish evolutionary relationships

  • Homology modeling approach:

    • Template selection (typically E. coli or Pseudomonas plsY structures)

    • Model refinement with energy minimization

    • Validation using Ramachandran plots and MolProbity scores

  • Structural comparison metrics:

    • RMSD calculations for backbone alignment

    • Conservation mapping onto structural models

    • Binding pocket volume and electrostatic potential analysis

Key structural features comparison:

Implications for drug design:

  • Identify unique structural features of B. mallei plsY for selective targeting

  • Target conserved regions for broad-spectrum inhibition

  • Explore differences in binding pocket architecture for specificity

What are the challenges in developing selective inhibitors for B. mallei plsY?

Developing selective inhibitors for B. mallei plsY faces several challenges that must be addressed through systematic medicinal chemistry and structure-based design approaches:

Selectivity challenges:

  • Cross-reactivity with related enzymes:

    • High sequence similarity between B. mallei and B. pseudomallei plsY (>99%)

    • Moderate conservation with other bacterial plsY enzymes (40-70%)

    • Potential off-target effects on other acyltransferases

  • Membrane protein inhibitor limitations:

    • Accessing membrane-embedded binding sites

    • Physicochemical requirements for membrane penetration

    • Complex protein-lipid interactions affecting binding

Methodological approaches to overcome challenges:

  • Structure-based design:

    • Identify subtle binding pocket differences between B. mallei and off-target enzymes

    • Design inhibitors exploiting unique structural features

    • Implement flexible docking to account for protein dynamics

  • Fragment-based approach:

    • Screen smaller fragments with higher binding efficiency

    • Link or grow fragments to improve potency while maintaining selectivity

    • Utilize structure-activity relationship data to guide optimization

  • Allosteric targeting strategy:

    • Identify non-conserved allosteric sites unique to B. mallei plsY

    • Develop inhibitors that stabilize inactive conformations

    • Test combinations of active site and allosteric inhibitors

  • Prodrug and targeted delivery:

    • Design membrane-permeable prodrugs activated by B. mallei enzymes

    • Develop bacterial membrane-targeting delivery systems

    • Exploit potential differences in cellular uptake mechanisms

Validation methodology:

  • Test against panels of related enzymes to quantify selectivity

  • Perform cellular studies in both bacterial and mammalian cells

  • Evaluate pharmacokinetics and tissue distribution in animal models

  • Monitor for emergence of resistance mechanisms

The development of truly selective inhibitors typically requires multiple iterations of design, synthesis, and testing, with careful attention to both on-target potency and off-target effects. While challenging, the unique biology of B. mallei provides opportunities for achieving the necessary selectivity for therapeutic applications .

How can computational approaches assist in predicting substrate specificity of B. mallei plsY?

Computational approaches offer powerful tools for predicting substrate specificity of B. mallei plsY, providing insights that can guide experimental design and inhibitor development:

Molecular modeling methodologies:

  • Homology modeling and refinement:

    • Generate B. mallei plsY models based on related bacterial structures

    • Refine with molecular dynamics to sample conformational space

    • Validate using energy metrics and structural quality assessment

  • Molecular docking approaches:

    • Virtual screening of acyl-CoA variants with different chain lengths

    • Scoring functions calibrated for membrane protein-ligand interactions

    • Ensemble docking using multiple protein conformations

  • Molecular dynamics simulations:

    • Membrane-embedded simulations (100-500 ns minimum)

    • Free energy calculations for substrate binding (MM-PBSA, FEP)

    • Identification of key binding determinants through interaction analysis

  • Machine learning integration:

    • Train models using experimental binding data from related enzymes

    • Feature extraction from protein sequence and structure

    • Prediction of substrate preference based on binding site properties

Specific analyses for substrate specificity prediction:

  • Binding pocket volume and shape complementarity assessment

  • Electrostatic complementarity analysis for charged substrates

  • Hydrogen bonding network prediction for different substrates

  • Hydrophobic interaction mapping for acyl chain accommodation

Validation methodology:

  • Correlate computational predictions with experimental binding assays

  • Iteratively refine models based on experimental feedback

  • Test predictions on engineered mutants with altered specificity

The most reliable predictions emerge from integrated approaches combining multiple computational methods with experimental validation. For membrane proteins like plsY, explicit consideration of the membrane environment is critical, requiring specialized simulation protocols that account for protein-lipid interactions affecting substrate access and binding .

What implications does B. mallei plsY have for understanding the evolution of host adaptation?

B. mallei plsY offers a unique window into understanding the evolution of host adaptation, as B. mallei represents a host-restricted pathogen that evolved from the environmentally versatile B. pseudomallei:

Evolutionary analysis methodology:

  • Comparative genomics approach:

    • Analyze plsY sequences across Burkholderia species

    • Calculate selection pressures (dN/dS ratios) on plsY

    • Identify lineage-specific mutations correlating with host adaptation

  • Structural evolution assessment:

    • Map sequence changes onto structural models

    • Identify alterations in substrate binding sites or regulatory regions

    • Correlate structural changes with host-specific environmental conditions

  • Functional evolution studies:

    • Compare enzymatic properties of plsY from B. mallei and B. pseudomallei

    • Assess substrate preference shifts that might reflect host adaptation

    • Evaluate temperature and pH optima differences related to host environments

Insights into host adaptation mechanisms:

B. mallei evolved from B. pseudomallei through substantial genome reduction, losing approximately 1,200 genes while retaining plsY, indicating its essential function . This evolutionary history provides several insights:

  • Conservation of plsY despite genome reduction suggests critical roles in both environmental survival and host pathogenesis

  • Potential adaptations in plsY might include:

    • Optimized activity at equine body temperature (37-38°C)

    • Adjusted substrate preference for host-available fatty acids

    • Modified regulation coordinating with host-specific signals

  • Comparative analysis with environmental Burkholderia species reveals how essential metabolic enzymes adapt during host restriction

The selective pressures on plsY during host adaptation may reveal broader principles about how essential metabolic enzymes evolve during pathogen specialization, with implications for understanding similar evolutionary processes in other host-adapted bacterial pathogens .

What role might B. mallei plsY play in biofilm formation and antimicrobial resistance?

B. mallei plsY may significantly influence biofilm formation and antimicrobial resistance through its central role in phospholipid biosynthesis, which affects membrane composition and bacterial surface properties:

Potential mechanisms in biofilm formation:

  • Membrane composition effects:

    • plsY activity influences phospholipid fatty acid composition

    • Membrane properties affect initial surface attachment

    • Phospholipids serve as precursors for biofilm matrix components

  • Stress response coordination:

    • Membrane remodeling during environmental transitions

    • Phospholipid composition changes affecting signaling pathways

    • Potential role in quorum sensing molecule production or detection

Antimicrobial resistance connections:

  • Membrane permeability modulation:

    • Altered acyl chain composition affects antibiotic penetration

    • Changes in membrane fluidity influence resistance to membrane-active agents

    • Modification of surface charge through phospholipid composition

  • Biofilm-associated resistance:

    • Contribution to biofilm matrix formation

    • Indirect effects on antibiotic diffusion through biofilms

    • Potential role in persister cell formation

Methodological approach to investigation:

  • Genetic manipulation studies:

    • Generate conditional plsY expression strains

    • Evaluate biofilm formation under varying plsY expression levels

    • Assess antimicrobial susceptibility under different conditions

  • Biochemical analyses:

    • Lipidomic profiling of planktonic versus biofilm cells

    • Correlation of membrane composition with resistance profiles

    • Binding studies of antimicrobials to membranes with altered composition

  • Microscopy and structural analyses:

    • Visualization of biofilm architecture using confocal microscopy

    • Evaluation of cell surface properties using atomic force microscopy

    • Assessment of membrane organization using fluorescence techniques

Current research with other bacterial pathogens suggests that phospholipid composition significantly influences both biofilm formation and antimicrobial resistance. For B. mallei, which can form biofilms that contribute to persistence in the environment and potentially in host tissues, plsY may represent a key regulator of these clinically relevant phenotypes. Understanding these connections could reveal new therapeutic approaches targeting bacterial membrane biosynthesis pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.