Recombinant Burkholderia mallei Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

MsbA is a homodimeric ABC transporter responsible for flipping lipid A (the hydrophobic anchor of LPS) from the cytoplasmic to the periplasmic leaflet of the inner membrane . In Burkholderia mallei, the causative agent of glanders, MsbA ensures proper LPS assembly, which is critical for bacterial survival and pathogenicity . The recombinant form of this protein (UniProt ID: Q62IG3) is expressed in E. coli with an N-terminal His tag for purification .

Domain Architecture

  • Transmembrane Domains (TMDs): Form the lipid A translocation pathway .

  • Nucleotide-Binding Domains (NBDs): Bind and hydrolyze ATP to drive transport .

Expression System

  • Host: Escherichia coli .

  • Tag: N-terminal His tag for affinity chromatography .

Mechanism of LPS Translocation

MsbA operates via a "trap-and-flip" model:

  1. LPS Binding: LPS enters the inward-facing TMDs, stabilized by interactions with conserved residues (Arg78, Arg148, Lys299) .

  2. ATP-Driven Conformational Change: ATP binding induces NBD dimerization, reorienting TMDs to expose LPS to the periplasmic leaflet .

  3. Release: Hydrolysis of ATP resets MsbA to its inward-facing state .

Key Experimental Findings

  • Mutations in LPS-binding residues (e.g., R78A/R148A/K299A) abolish ATPase stimulation by LPS .

  • Cryo-EM structures show LPS acyl chains reaching the periplasmic leaflet without full flipping, suggesting partial translocation during transport .

Antimicrobial Target

MsbA is a potential target for novel antibiotics, as its inhibition disrupts LPS assembly and bacterial viability .

Diagnostic Development

Recombinant MsbA has been explored for serodiagnosis of Burkholderia infections due to its immunogenic properties .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, kindly specify them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Please note that all of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement to us in advance. Additional fees will be applied for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
msbA; BMA1912; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Burkholderia mallei (strain ATCC 23344)
Target Names
msbA
Target Protein Sequence
MSVKPTLSKPIGGQDASSPAVVMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKP LLDHGFGSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMI HTGVSFFQRETASTVINAVVFEVNQVLSVLMGVTITLVRDSLTVVFLLGYLFYLNWRLTL IVAILLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGEPYEIGR FNELSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSANDQTTVGGFVAFVT AMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSF SYGMSRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGSVRVDGVAL PEYSLRDLRNQIAMVSQDVVLFNDTIAANVAYGQAPERDRVEAALRAANLWETVTAMPDG IDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMKG RTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of lipopolysaccharide (LPS). It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: bma:BMA1912

STRING: 243160.BMA1912

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia mallei MsbA and what is its function?

Burkholderia mallei MsbA is a Lipid A export ATP-binding/permease protein belonging to the ABC transporter family. It consists of 596 amino acids and is encoded by the msbA gene (locus BMA1912) . MsbA functions as a transmembrane flippase that transports lipopolysaccharide (LPS) components, specifically Lipid A, from the inner leaflet to the outer leaflet of the inner membrane in this Gram-negative bacterium. This process is essential for outer membrane biogenesis, which serves as a protective barrier for the bacterium. Functionally, MsbA exhibits ATPase activity (EC 3.6.3.-) and utilizes energy from ATP hydrolysis to translocate its substrate across the membrane .

What is the structural composition of MsbA in Burkholderia mallei?

Burkholderia mallei MsbA is a transmembrane protein with a characteristic structure typical of ABC transporters. The protein consists of:

  • Transmembrane domains (TMDs) that form a channel across the membrane

  • Nucleotide-binding domains (NBDs) that bind and hydrolyze ATP

  • A full sequence length of 596 amino acids

The amino acid sequence reveals a protein rich in hydrophobic regions necessary for membrane insertion. While no crystal structure specifically for B. mallei MsbA is reported in the search results, structural studies of homologous MsbA proteins indicate that it likely undergoes significant conformational changes during its transport cycle, transitioning between inward-facing and outward-facing conformations to facilitate substrate translocation . These conformational changes are critical for understanding the protein's mechanism of action.

What techniques are used to express and purify recombinant MsbA?

The expression and purification of recombinant MsbA involves several specialized techniques:

Expression:

  • E. coli expression systems are primarily used (typically BL21 strains)

  • Expression vectors containing N-terminal His-tags facilitate purification

  • IPTG-induced expression under controlled temperature conditions

  • Growth in LB medium supplemented with appropriate antibiotics

Purification:

  • Cell disruption using high-pressure microfluidizers

  • Membrane isolation via ultracentrifugation (100,000×g for 1 hour at 4°C)

  • Membrane solubilization using detergents like n-dodecyl-β-D-maltopyranoside (DDM)

  • Metal affinity chromatography (TALON resin) exploiting the His-tag

  • Size-exclusion chromatography for higher purity

  • Storage in Tris-based buffer with 50% glycerol

These methods must be performed with careful attention to protein stability, as membrane proteins are notoriously difficult to maintain in their native conformation during purification processes.

What expression systems are optimal for the production of recombinant Burkholderia mallei MsbA?

E. coli-based expression systems have consistently demonstrated optimal results for recombinant B. mallei MsbA production . The following specific conditions have proven most effective:

Optimal expression parameters:

  • Strain selection: E. coli BL21 Star™ (DE3) pLysS for membrane protein expression

  • Vector design: pET-series vectors with N-terminal His-tags (10×His tag reported in product descriptions)

  • Growth conditions: 37°C in LB medium with appropriate antibiotics

  • Induction strategy: 0.5 mM IPTG followed by 3-hour post-induction growth

  • Harvest method: Centrifugation and storage at -80°C before processing

This consistent preference for E. coli expression systems across multiple sources reflects challenges in expressing this complex membrane protein in alternative hosts. The E. coli system provides a balance between yield, proper folding, and ease of purification that has made it the standard for MsbA production .

How can the functionality of purified recombinant MsbA be assessed?

Multiple complementary approaches can be employed to assess the functionality of purified recombinant MsbA:

  • ATPase activity assays: Quantifying ATP hydrolysis rates using colorimetric phosphate detection methods to confirm enzymatic function

  • Liposome reconstitution: Incorporation of purified MsbA into artificial lipid bilayers to measure transport activity

  • Substrate binding assays: Fluorescence-based or radioligand binding assays to verify Lipid A recognition

  • Conformational analysis: Techniques including:

    • Limited proteolysis to assess protein folding

    • Fluorescence spectroscopy to monitor structural changes

    • EPR spectroscopy to examine conformational dynamics

  • Thermal stability assessment: Differential scanning fluorimetry to measure protein stability and proper folding

  • Structural verification: Circular dichroism spectroscopy to confirm secondary structure content

These multifaceted approaches provide comprehensive evidence of proper protein folding and function, ensuring that the recombinant protein retains its native characteristics for subsequent experimental applications.

How can MsbA be used as a diagnostic target for glanders?

While the search results don't specifically mention MsbA as an established diagnostic target, its potential application in glanders diagnostics could be developed through several approaches:

  • Serological detection: Recombinant MsbA could be utilized in ELISA-based assays to detect anti-MsbA antibodies in serum samples from infected hosts, similar to approaches described for other B. mallei proteins .

  • PCR-based detection: Species-specific regions within the msbA gene could serve as targets for PCR-based identification of B. mallei, though careful primer design would be necessary given the high sequence similarity with B. pseudomallei.

  • Mass spectrometry approaches: Protein signature profiles incorporating MsbA could contribute to MALDI-TOF MS identification methods, which have shown promise for rapid identification of B. mallei .

The primary challenge in using MsbA for diagnostics stems from the high sequence similarity between B. mallei and B. pseudomallei proteins (>99% identity). Successful diagnostic application would require identification of species-specific epitopes or sequence variations that could differentiate between these closely related pathogens .

What is the role of MsbA in Burkholderia mallei virulence?

MsbA's contribution to B. mallei virulence is multifaceted, though indirect:

  • LPS biogenesis: As a Lipid A transporter, MsbA is essential for the proper assembly of lipopolysaccharide in the outer membrane. LPS represents a major virulence factor in Gram-negative bacteria, contributing to resistance against host immune defenses.

  • Membrane integrity: By facilitating outer membrane biogenesis, MsbA helps maintain the structural integrity that protects the bacterium from host defense mechanisms and antimicrobial compounds.

  • Antibiotic resistance: B. mallei and B. pseudomallei are "intrinsically resistant to many antibiotics" . MsbA's role in membrane assembly likely contributes to this resistance profile.

  • Pathogen survival: While not explicitly described as a virulence factor itself, MsbA's essential function in membrane biogenesis makes it critical for pathogen survival in hostile host environments.

This integral role in maintaining bacterial membrane structure positions MsbA as an important indirect contributor to virulence, even if it doesn't directly interact with host cells like other virulence factors described in the literature .

How can site-directed mutagenesis be used to study MsbA function?

Site-directed mutagenesis offers a powerful approach to dissect the structure-function relationships of MsbA through targeted amino acid substitutions:

  • ATP binding and hydrolysis sites: Mutations in the Walker A and Walker B motifs of the nucleotide-binding domains can reveal the energetic requirements for transport. Conservative substitutions (e.g., K→R in the Walker A motif) can distinguish between ATP binding and hydrolysis requirements.

  • Transmembrane domains: Systematic mutagenesis of residues in the transmembrane helices can identify amino acids critical for:

    • Channel formation

    • Substrate recognition

    • Conformational flexibility during the transport cycle

  • Substrate binding pocket: Mutations in residues predicted to interact with Lipid A can elucidate the molecular basis of substrate specificity.

  • Dimer interface: As ABC transporters typically function as dimers, mutations at the dimer interface can reveal the importance of oligomerization for function.

  • Conserved motifs: Analysis of the sequence reveals conserved motifs characteristic of ABC transporters that can be targeted for mutagenesis.

The effects of these mutations can be analyzed through functional assays measuring ATPase activity, transport capacity, and conformational changes to build a comprehensive understanding of structure-function relationships in this important membrane transporter.

What are the known structural differences between MsbA in Burkholderia mallei and other bacterial species?

While the search results don't provide specific structural comparisons between B. mallei MsbA and homologs from other species, several inferences can be made from sequence comparisons:

  • Sequence variation: Comparing MsbA sequences from B. mallei (596 aa) , B. pseudomallei (596 aa) , and Blochmannia floridanus (583 aa) reveals differences in primary structure that likely translate to structural variations.

  • Species-specific adaptations: These sequence differences may reflect adaptations to:

    • Species-specific Lipid A structures

    • Membrane composition variations

    • Different environmental conditions

  • Functional domains: While the core functional domains (NBDs and TMDs) are likely conserved across species, variations in connecting regions and surface-exposed loops may contribute to species-specific interactions.

A comprehensive structural comparison would require high-resolution structural data (X-ray crystallography or cryo-EM) for B. mallei MsbA, which is not reported in the provided search results. The closest structural insights come from E. coli MsbA studies , which provide a foundation for understanding the general structural principles of this protein family.

How can structural studies of MsbA inform drug design efforts?

Structural studies of MsbA provide critical insights that can guide rational drug design targeting this essential bacterial protein:

  • Binding pocket identification: Structural analysis reveals potential drug binding sites, particularly:

    • The ATP binding pocket

    • The substrate binding cavity

    • Interfaces critical for conformational changes

  • Conformational analysis: Understanding the "conformational transitions of MsbA to flip LPS" can inform the design of inhibitors that lock the protein in non-functional conformations.

  • Structure-based virtual screening: MsbA structures enable computational screening of compound libraries to identify potential inhibitors with favorable binding properties.

  • Fragment-based approaches: Structural data guides fragment-based drug discovery, where molecular fragments binding to different protein regions are identified and linked to create potent inhibitors.

  • Species comparisons: Structural comparison between MsbA from different bacteria can highlight:

    • Conserved regions for broad-spectrum inhibitor design

    • Unique features for species-specific targeting

  • Substrate interaction analysis: Detailed understanding of how MsbA recognizes LPS/Lipid A can inform the design of competitive inhibitors that disrupt this essential interaction .

These structure-guided approaches can accelerate the development of novel antimicrobials targeting MsbA, addressing the urgent need for new treatments against drug-resistant pathogens like B. mallei.

What are the challenges in studying MsbA as a potential drug target?

Investigating MsbA as a drug target presents several significant challenges:

  • Membrane protein complexity: As a transmembrane protein, MsbA is inherently difficult to work with, requiring specialized techniques for expression, purification, and structural studies .

  • Species similarity: The high sequence identity between B. mallei and B. pseudomallei MsbA proteins (>99%) complicates the development of species-specific inhibitors.

  • Conservation across bacteria: MsbA homologs exist in many bacteria, including commensal and beneficial species, raising concerns about potential off-target effects of MsbA inhibitors.

  • Conformational dynamics: The multiple conformational states adopted during the transport cycle add complexity to inhibitor design, as the protein presents different binding surfaces in different states.

  • Limited structural data: While structural information exists for E. coli MsbA , specific structural data for B. mallei MsbA appears limited in the literature.

  • Biosafety restrictions: As B. mallei is classified as a Tier 1 Select Agent , research requires high-level biosafety facilities, limiting accessibility for many research groups.

  • Model development: Creating appropriate models to test inhibitor efficacy presents challenges due to the specialized nature of MsbA's function and the pathogenic nature of B. mallei.

Despite these challenges, MsbA remains an attractive target due to its essential role in bacterial viability and potential contribution to antimicrobial resistance.

What are the best approaches for studying MsbA-LPS interactions?

Investigating the critical interactions between MsbA and its LPS substrate requires a multifaceted approach:

  • Structural methods:

    • Cryo-electron microscopy has been successfully employed to visualize MsbA-LPS complexes

    • X-ray crystallography of MsbA with bound LPS analogs can provide atomic-level interaction details

    • NMR studies of specific domains with LPS fragments can reveal dynamic aspects of binding

  • Biochemical techniques:

    • Surface plasmon resonance to measure binding kinetics and affinity

    • Isothermal titration calorimetry to determine thermodynamic parameters of binding

    • Fluorescence-based assays using labeled LPS derivatives

  • Functional approaches:

    • Reconstitution into liposomes to measure LPS/Lipid A transport activity

    • ATPase stimulation assays to correlate substrate binding with enzymatic activity

  • Molecular biology methods:

    • Site-directed mutagenesis of predicted LPS-interacting residues

    • Domain swapping between species to identify substrate specificity determinants

  • Computational analyses:

    • Molecular dynamics simulations to model MsbA-LPS interactions in membrane environments

    • Docking studies to predict binding modes and energetics

  • Cross-linking approaches:

    • Chemical cross-linking coupled with mass spectrometry to identify residues proximal to bound substrate

The combination of these approaches provides a comprehensive understanding of the molecular basis of MsbA-LPS recognition and transport, critical for both basic science and drug discovery applications.

What are the recommended protocols for maintaining stability of recombinant MsbA during purification?

Maintaining the stability of recombinant MsbA during purification requires careful attention to several critical parameters:

Storage conditions:

  • Store at -20°C or preferably -80°C for extended storage

  • Prepare small working aliquots to keep at 4°C for up to one week only

  • Strictly avoid repeated freeze-thaw cycles which cause significant degradation

Buffer composition:

  • Use Tris-based buffer (pH 7.8-8.0) with 50% glycerol as a stabilizing agent

  • Include salt (150 mM NaCl) to maintain ionic strength

  • Add reducing agents like TCEP (1 mM) to prevent oxidation of cysteine residues

Detergent considerations:

  • Maintain critical micelle concentration of detergent (1 mM DDM recommended)

  • Consider detergent screening if stability issues are encountered

Purification strategy:

  • Multi-step approach: Metal affinity chromatography followed by size-exclusion chromatography

  • Perform all purification steps at 4°C to minimize degradation

  • Consider addition of 5-6% trehalose as an additional stabilizer

Quality control:

  • Verify protein integrity by SDS-PAGE before storage

  • Monitor monodispersity using dynamic light scattering

  • Assess activity immediately after purification as a baseline for stability studies

Adherence to these protocols significantly enhances the stability and functional integrity of recombinant MsbA preparations, ensuring reliable results in subsequent experimental applications.

How does MsbA contribute to antimicrobial resistance in Burkholderia mallei?

MsbA's contribution to antimicrobial resistance in B. mallei operates through several mechanisms:

  • Outer membrane integrity: As a critical component in LPS transport, MsbA helps establish the permeability barrier of the outer membrane, which restricts the entry of many antibiotics, particularly hydrophobic compounds .

  • LPS modification pathway: While not directly modifying LPS itself, MsbA transports LPS molecules that may contain modifications conferring resistance to antimicrobial peptides and other host defense molecules.

  • Potential efflux activity: As an ABC transporter, MsbA may have broad substrate specificity beyond its primary LPS transport function, potentially contributing to efflux of certain antimicrobial compounds.

  • Intrinsic resistance profile: Both B. mallei and B. pseudomallei are noted to be "intrinsically resistant to many antibiotics" . While the specific contribution of MsbA to this intrinsic resistance isn't detailed in the search results, its fundamental role in membrane biogenesis likely plays an important part.

  • Adaptation to environmental stress: MsbA's function in maintaining membrane homeostasis may contribute to the bacterium's ability to adapt to stress conditions, including exposure to antimicrobial agents.

Understanding MsbA's role in antimicrobial resistance mechanisms could potentially inform strategies to overcome resistance in B. mallei infections, which represent a significant treatment challenge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.