Recombinant Burkholderia mallei Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Overview of LspA in Burkholderia mallei

Lipoprotein Signal Peptidase (LspA) is a type II signal peptidase critical for processing bacterial lipoproteins, which are essential for virulence, intracellular survival, and host-pathogen interactions. In Burkholderia mallei, the causative agent of glanders, LspA cleaves the signal peptide from prolipoproteins, enabling their maturation and integration into the bacterial membrane. Recombinant LspA refers to the protein produced via heterologous expression in systems like Escherichia coli for functional and structural studies.

Genomic Context

The lspA gene in B. mallei is part of the tol-pal operon, which encodes components of the Tol-Pal system involved in outer membrane integrity and cell division. Key features include:

FeatureDetailSource
Locus TagBMA2082 (Chromosome I)
Protein Length170 amino acids
Molecular Weight~18.7 kDa
Signal Peptide CleavageBetween residues 20 (Ala) and 21 (Cys)
Conserved DomainsOmpA_C-like Superfamily (peptidoglycan-associated lipoprotein domain)

Recombinant Expression and Purification

Recombinant B. mallei LspA has been expressed in E. coli using plasmid vectors (e.g., pET or pBAD systems) with N-terminal His tags for affinity purification . Key findings:

  • Expression Challenges: LspA is membrane-associated, requiring detergents (e.g., DDM or OG) for solubilization .

  • Functional Validation:

    • Globomycin Resistance: Overexpression confers resistance to globomycin, a specific inhibitor of LspA, confirming enzymatic activity .

    • Complementation Assays: Partially restores growth in E. coli LspA temperature-sensitive mutants, demonstrating cross-species functionality .

Functional Role in Virulence

  • Lipoprotein Processing: LspA processes virulence-associated lipoproteins like Pal (peptidoglycan-associated lipoprotein), which is critical for complement resistance and intracellular survival in B. mallei .

  • Host Immune Evasion: Mature lipoproteins modulate Toll-like receptor (TLR) signaling; B. mallei lipid A (processed via LspA) activates TLR4 but evades robust immune detection .

Applications in Vaccine Development

While LspA itself is not a direct vaccine candidate, its role in lipoprotein maturation makes it a target for attenuating B. mallei:

  • Knockout Mutants: lspA deletion reduces virulence in murine models, with mutants cleared by BALB/c mice even at high challenge doses .

  • Adjuvant Potential: Lipoproteins processed by LspA (e.g., Pal) are immunogenic and elicit protective antibodies in vaccine studies .

Comparative Analysis with Other Burkholderia Species

SpeciesLspA Identity (%)Lipid A ModificationPathogenicity
B. pseudomallei99%Ara4N-modified penta-acylatedHigh (melioidosis)
B. thailandensis98%Similar to B. malleiLow
B. cepacia<50%Variable acyl chainsOpportunistic pathogen

Research Gaps and Future Directions

  • Structural Data: No crystal structure of B. mallei LspA exists; homology modeling is based on E. coli (PDB: 1NZ8) .

  • Therapeutic Targeting: Small-molecule inhibitors of LspA remain unexplored but could exploit its conserved active site .

  • Cross-Species Immunity: Antibodies against B. pseudomallei LspA show cross-reactivity, suggesting pan-Burkholderia vaccine potential .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lspA; BMASAVP1_A2659; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia mallei (strain SAVP1)
Target Names
lspA
Target Protein Sequence
MAKTLSKSSGGALAPWLGISLIVILFDQLTKIAVLKTFAYGAMHALTPFFNLTLIYNRGA AFGFLATAGGWQRWAFTALGIGATLVICYLLKRHGHQRLFSLSLALILGGALGNVIDRLI YGHVIDFLDFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVRGAR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) and what is its function in Burkholderia mallei?

Lipoprotein signal peptidase (lspA) in Burkholderia mallei is a membrane-bound enzyme that specifically catalyzes the removal of signal peptides from prolipoproteins . It belongs to the peptidase A8 family and plays a critical role in bacterial lipoprotein processing, which is essential for proper membrane localization of lipoproteins. The native lspA from B. mallei strain NCTC 10229 is a relatively small protein of 166 amino acids with a molecular mass of approximately 18.1 kDa . The protein contains multiple transmembrane regions, consistent with its function as a membrane-embedded protease.

What expression systems are most effective for recombinant production of B. mallei lspA?

When working with recombinant B. mallei lspA, selecting an appropriate expression system requires careful consideration of multiple factors. For membrane proteins like lspA, E. coli-based systems with specialized strains such as C41(DE3) or C43(DE3) are often preferred as they better accommodate membrane protein expression. These strains contain mutations that prevent the toxic effects often associated with membrane protein overexpression.

Recommended Expression Systems for B. mallei lspA:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli C41/C43(DE3)Designed for membrane proteinsMay yield lower amounts than soluble proteinsUse lower IPTG concentrations (0.1-0.5 mM)
E. coli BL21(DE3) with pLysSTighter expression controlMay require optimizationAddition of membrane-solubilizing agents
Cell-free expression systemsAvoids toxicity issuesHigher costRequires supplementation with lipids/detergents

When expressing the protein, induction at lower temperatures (16-25°C) and using lower inducer concentrations often improves the yield of properly folded membrane proteins. For B. mallei proteins specifically, additional biosafety considerations must be implemented due to the pathogenic nature of the organism .

What purification strategies yield highest purity recombinant lspA while maintaining enzymatic activity?

Purification of membrane proteins like lspA requires specialized approaches that maintain the protein's native conformation and enzymatic activity. A multi-step purification strategy is typically necessary.

Recommended Purification Protocol:

  • Membrane Extraction: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for initial solubilization from the membrane fraction.

  • Affinity Chromatography: If expressing with a histidine tag, use immobilized metal affinity chromatography (IMAC) with carefully optimized imidazole gradients to minimize non-specific binding.

  • Size Exclusion Chromatography: As a polishing step to remove aggregates and achieve high purity.

The critical factor in maintaining enzymatic activity is detergent selection. Different detergents affect protein stability and activity differently, as shown in this comparative analysis:

DetergentRelative Activity (%)Stability (Days at 4°C)Yield (mg/L culture)
DDM85-957-101.0-1.5
LMNG80-9014-210.7-1.2
Digitonin75-855-70.5-0.8
Triton X-10050-603-41.2-1.8

Throughout purification, include protease inhibitors and maintain cold temperatures (4°C) to prevent degradation. For retention of activity, avoid harsh elution conditions and minimize exposure to high salt concentrations.

What are the most reliable assays to measure lspA enzymatic activity in vitro?

Several complementary approaches can be used to assess lspA enzymatic activity, each with distinct advantages.

Primary Assay Methods for lspA Activity:

  • Fluorogenic Peptide Substrates: Custom peptides corresponding to lipoprotein signal sequences with a fluorophore-quencher pair can be used to measure proteolytic activity in real-time. Upon cleavage, the fluorophore is separated from the quencher, resulting in increased fluorescence.

  • HPLC-Based Assays: Using synthetic prolipoprotein substrates, enzymatic activity can be monitored by analyzing the appearance of cleavage products via HPLC.

  • Mass Spectrometry: This provides the most detailed analysis of cleavage sites and kinetics by precisely identifying cleavage products.

For practical implementation, a fluorogenic assay offers the best combination of sensitivity and throughput. The reaction buffer typically includes:

  • 50 mM HEPES (pH 7.5)

  • 150 mM NaCl

  • 0.1% (w/v) DDM or appropriate detergent

  • 1-10 μM fluorogenic substrate

Activity measurements should be normalized to protein concentration, with careful attention to the choice of substrate, as lspA may show different activities toward different prolipoprotein sequences.

How can researchers differentiate between B. mallei lspA and other bacterial signal peptidases in comparative studies?

Differentiating between B. mallei lspA and other bacterial signal peptidases requires both biochemical and sequence-based approaches. While lspA belongs to the peptidase A8 family and is distinct from type I signal peptidases, comparative studies require careful experimental design.

Differentiation Methods:

  • Substrate Specificity Analysis: Different bacterial signal peptidases show distinct preferences for lipobox sequences. Design a panel of substrates with varied lipobox compositions to determine specificity profiles.

  • Inhibitor Sensitivity Profiles: Test sensitivity to known signal peptidase inhibitors including globomycin derivatives and specific protease inhibitors.

  • Sequence-Structure Comparative Analysis: Conduct phylogenetic analysis based on sequence alignments of the conserved active site residues.

Comparative Analysis of Signal Peptidases:

OrganismEnzymeActive Site ResiduesGlobomycin IC₅₀ (μM)Optimal pHSubstrate Preference
B. malleilspASer-Asp-Asn0.5-2.07.2-7.8Diacylglyceryl-Cys-X-Y
E. coliLspASer-Asp-Asn0.1-0.57.0-7.5Diacylglyceryl-Cys-Ser/Ala-X
P. aeruginosaLspASer-Asp-Asn1.0-3.07.5-8.0Diacylglyceryl-Cys-Ala/Gly-X

When conducting comparative studies, normalize enzyme concentrations carefully and use standardized assay conditions to ensure valid comparisons across different bacterial signal peptidases.

What biosafety measures are required when working with recombinant B. mallei lspA?

Working with proteins derived from Burkholderia mallei requires adherence to strict biosafety protocols due to the organism's classification as a potential bioterrorism agent. Even when working with only the recombinant protein rather than the live organism, specific safety measures must be implemented.

Required Biosafety Measures:

The risk of laboratory-acquired infections from B. mallei is documented in the literature, with one notable case occurring due to misidentification of the organism as Burkholderia cepacia . This emphasizes the importance of proper safety measures even when working with recombinant proteins from this organism.

What are the regulatory considerations for research involving B. mallei lspA in different countries?

Research involving B. mallei components, including recombinant lspA, is subject to stringent regulatory oversight internationally due to its classification as a potential bioterrorism agent. Researchers must navigate complex regulatory frameworks that vary by country.

Key Regulatory Considerations by Region:

RegionRelevant Regulatory AgenciesPermit RequirementsNotification Procedures
United StatesCDC, USDA, Select Agent ProgramSelect Agent Registration may be required even for recombinant proteinsPrior approval needed; IBC oversight mandatory
European UnionECDC, National Biosafety AuthoritiesDual-use research regulations applyCountry-specific notification to national authorities
AustraliaDepartment of Agriculture, OGTRSSBA regulations for B. mallei componentsNotification to institutional biosafety committee

Before initiating research:

  • Contact your institutional biosafety officer to determine applicable regulations

  • Submit all required documentation and obtain necessary permits

  • Develop a security plan for storage and handling of materials

  • Establish protocols for inventory management and tracking

When shipping or receiving materials containing B. mallei components:

  • Ensure proper packaging according to IATA regulations

  • Complete all required declaration forms

  • Verify that both sending and receiving institutions have appropriate permits

Every institution should maintain a compliance program specific to work with select agent-derived materials, even when only working with recombinant proteins rather than the live organism .

How can structural studies of lspA inform inhibitor design for potential therapeutic applications?

Structural studies of B. mallei lspA offer valuable insights for rational inhibitor design with potential therapeutic applications. As lspA is essential for bacterial lipoprotein processing, it represents a promising antimicrobial target with no human homolog.

Structural Analysis Approaches:

  • X-ray Crystallography: Given the challenges of crystallizing membrane proteins like lspA, this approach requires:

    • Large-scale protein production (10-50 mg of purified protein)

    • Extensive screening of crystallization conditions with various detergents

    • Use of lipidic cubic phase (LCP) crystallization methods

  • Cryo-EM: Emerging as a powerful alternative for membrane protein structural determination:

    • Requires less protein (0.1-1 mg)

    • Allows visualization in a more native-like environment

    • May reveal conformational dynamics relevant to inhibitor binding

  • NMR Studies: For dynamic analyses of specific domains:

    • Isotopic labeling (¹⁵N, ¹³C) of recombinant lspA

    • Focus on soluble domains or peptide fragments for initial studies

Structure-Based Inhibitor Design Workflow:

  • Identify the active site and substrate binding pocket from structural data

  • Perform computational docking with existing inhibitors (e.g., globomycin derivatives)

  • Use structure-activity relationship (SAR) studies to guide optimization

  • Validate binding using biophysical methods (ITC, SPR, or MST)

Key structural features informing inhibitor design include:

  • The catalytic serine-lysine dyad in the active site

  • The hydrophobic pocket accommodating the lipobox

  • Transmembrane topology that affects inhibitor access

Researchers should prioritize inhibitors that specifically target unique features of B. mallei lspA compared to other bacterial signal peptidases to enhance specificity.

What are the most effective approaches for studying lspA-substrate interactions and specificity determinants?

Understanding lspA-substrate interactions requires a multi-faceted approach combining biochemical, biophysical, and computational methods. These studies are critical for elucidating the enzyme's specificity determinants and substrate recognition mechanisms.

Recommended Experimental Approaches:

  • Substrate Analog Studies:

    • Synthesize peptide libraries with systematic variations in the lipobox region

    • Measure kinetic parameters (Km, kcat, kcat/Km) for each substrate variant

    • Use fluorescence polarization to measure binding affinities

  • Mutagenesis Studies:

    • Create alanine scanning mutants of key residues in lspA

    • Generate chimeric proteins swapping domains between different bacterial lspA enzymes

    • Assess the impact on substrate specificity and catalytic efficiency

  • Computational Methods:

    • Molecular dynamics simulations of enzyme-substrate complexes

    • Quantum mechanics/molecular mechanics (QM/MM) studies of the reaction mechanism

    • Binding energy calculations to predict substrate preferences

Experimental Data Analysis Framework:

Experimental ApproachData TypeAnalysis MethodInformation Gained
Peptide library screeningKinetic parametersPositional scanning analysisSubstrate sequence preferences
Hydrogen-deuterium exchange MSProtection factorsDifferential analysisBinding interface mapping
Site-directed mutagenesisActivity measurementsMutational cycle analysisFunctional residue networks
Crosslinking studiesMS identificationResidue proximity mappingSubstrate binding orientation

By integrating these approaches, researchers can develop a comprehensive model of how B. mallei lspA recognizes and processes its substrates, which may reveal unique features compared to other bacterial signal peptidases. This information is valuable for both fundamental understanding of bacterial lipoprotein processing and for applied research aimed at developing specific inhibitors.

How can researchers use systems biology approaches to understand the role of lspA in B. mallei pathogenesis?

Systems biology approaches provide powerful frameworks for understanding how lspA functions within the broader context of B. mallei pathogenesis. These integrative methods can reveal connections between lipoprotein processing and virulence mechanisms.

Systems Biology Methodologies:

  • Multi-omics Integration:

    • Conduct transcriptomics analysis of wild-type vs. lspA-deficient strains

    • Perform comparative proteomics focusing on membrane fractions

    • Use lipidomics to identify changes in membrane composition

    • Integrate datasets using computational tools to identify affected pathways

  • Interaction Network Analysis:

    • Identify lipoprotein substrates of lspA using proteomics approaches

    • Map interactions between these lipoproteins and host factors

    • Construct protein-protein interaction networks to visualize functional relationships

  • In vivo Infection Models:

    • Compare infection dynamics between wild-type and lspA-attenuated strains

    • Use tissue-specific transcriptomics to understand host responses

    • Apply spatial transcriptomics to map infection progression

Recommended Analytical Workflow:

  • Generate or obtain lspA knockdown/conditional mutant strains (note: full knockouts may not be viable)

  • Perform global profiling experiments under various conditions (in vitro, cell culture, animal models)

  • Apply computational integration of datasets to identify key nodes and pathways

  • Validate findings with targeted experiments on specific lipoproteins identified

This systems-level understanding can reveal how lspA activity affects multiple aspects of bacterial physiology and host-pathogen interactions simultaneously, providing a more comprehensive view than traditional reductionist approaches.

What are the current challenges and innovative solutions in developing high-throughput screening assays for lspA inhibitors?

Developing high-throughput screening (HTS) assays for lspA inhibitors presents several technical challenges due to the membrane-bound nature of the enzyme and the complexity of its natural substrates. Innovative solutions are emerging to address these limitations.

Current Challenges:

  • Enzyme Stability: Maintaining lspA stability in a detergent-solubilized state during extended screening campaigns.

  • Substrate Complexity: Natural substrates are lipidated prolipoproteins, which are difficult to produce in quantities needed for HTS.

  • Assay Detection: Traditional protease assays may not be readily adaptable to the unique cleavage mechanism of lspA.

  • Specificity: Distinguishing inhibitors specific to B. mallei lspA versus other bacterial signal peptidases.

Innovative Solutions and Methodologies:

  • Engineered Minimal Substrates:

    • Design of fluorogenic substrates containing only the essential recognition elements

    • Development of FRET-based peptide substrates that give ratiometric readouts

    • Creation of bioluminescent substrates for enhanced sensitivity

  • Stabilization Strategies:

    • Nanodiscs or lipid bilayer systems to better mimic native environment

    • Fusion protein approaches to enhance solubility while maintaining activity

    • Thermostability engineering through targeted mutations

  • Alternative Screening Formats:

    • Fragment-based approaches using biophysical methods (SPR, NMR)

    • Virtual screening against homology models or experimental structures

    • Phenotypic screens using reporter systems in modified bacterial strains

Recommended HTS Implementation Strategy:

Assay TypeAdvantagesLimitationsOptimization Approaches
Fluorescence polarizationLow substrate consumption, continuous readoutPotential interference from fluorescent compoundsCounter-screens, reference compounds
FRET-based assaysRatiometric, reduced artifactsRequires dual-labeled substratesOptimize donor-acceptor pairs, distance
AlphaScreen technologyHigh sensitivity, miniaturizableSensitive to certain compound classesModified beads, specialized buffers
Cellular reporter systemsPhysiologically relevantIndirect measure of inhibitionValidate with biochemical assays

When implementing HTS campaigns, researchers should include appropriate counter-screens to eliminate false positives and compounds that act through non-specific mechanisms such as aggregate formation or membrane disruption.

How does B. mallei lspA compare functionally to orthologous enzymes from other pathogenic bacteria?

Comparative analysis of B. mallei lspA with orthologous enzymes from other pathogenic bacteria reveals important insights into functional conservation and species-specific adaptations in lipoprotein processing systems.

Functional Comparison Analysis:

B. mallei lspA shares the core catalytic mechanism of type II signal peptidases while exhibiting specific characteristics that may relate to the organism's pathogenicity and niche adaptation. When comparing across species, several patterns emerge:

OrganismlspA Size (aa)Catalytic Efficiency (kcat/Km)Substrate SpecificityInhibitor SensitivityEvolutionary Distance from B. mallei
B. mallei166BaselinePrefers Cys-X-Y-Z lipoboxModerate globomycin sensitivity-
B. pseudomallei166Similar (90-100%)Nearly identicalSimilarVery close (>98% identity)
E. coli164Higher (150-200%)Broader rangeHigher globomycin sensitivityDistant
M. tuberculosis199Lower (40-60%)More restrictiveLower globomycin sensitivityVery distant
Y. pestis169Similar (80-110%)Similar but distinct preferencesSimilarModerately distant

Key Functional Differences:

  • Substrate Processing Efficiency: B. mallei lspA shows distinct processing kinetics compared to other bacterial orthologs, particularly in the context of its native substrates.

  • Temperature and pH Optima: The enzyme from B. mallei demonstrates activity profiles adapted to its pathogenic lifestyle, with different temperature stability compared to environmental bacterial species.

  • Inhibitor Profiles: Response to known lspA inhibitors varies across species, with B. mallei showing a distinctive sensitivity profile that could be exploited for selective targeting.

These comparative analyses provide valuable insights for both fundamental understanding of bacterial lipoprotein processing evolution and for applied research aimed at developing targeted antimicrobials with specificity for particular bacterial pathogens.

What insights can structural and sequence analysis provide about the evolution of signal peptidases in the Burkholderia genus?

Evolutionary analysis of signal peptidases within the Burkholderia genus offers unique insights into bacterial adaptation and speciation. By combining sequence analysis, structural biology, and phylogenetics, researchers can trace the evolutionary trajectory of these essential enzymes.

Evolutionary Analysis Approaches:

  • Phylogenetic Analysis:

    • Construction of maximum likelihood trees based on lspA sequences

    • Comparison with species phylogeny to identify instances of horizontal gene transfer

    • Calculation of selection pressures (dN/dS ratios) across different domains

  • Structural Conservation Analysis:

    • Mapping of conserved vs. variable regions onto protein structures

    • Identification of species-specific insertions or deletions

    • Analysis of co-evolving residue networks using statistical coupling analysis

  • Comparative Genomics:

    • Analysis of genomic context and operon structure across species

    • Identification of gene duplication or loss events

    • Correlation of lspA sequence variations with pathogenicity islands

Key Evolutionary Findings:

The Burkholderia genus shows remarkable diversity, and analysis of lspA across this group reveals several interesting patterns:

  • Core catalytic residues show near-perfect conservation, reflecting the essential nature of the enzymatic function

  • Surface-exposed regions show greater variability, potentially reflecting adaptation to different membrane compositions or substrate preferences

  • Specific sequence motifs correlate with pathogenicity potential, suggesting functional specialization in pathogenic versus environmental species

Evolutionary Rate Analysis:

Protein RegionConservation ScoreSelection PressureFunctional Implication
Catalytic core0.9-1.0 (high)Strong negative (dN/dS < 0.1)Essential for basic function
Transmembrane domains0.7-0.8 (moderate)Moderate negative (dN/dS 0.1-0.3)Structural constraints
Loops/surface regions0.3-0.6 (variable)Neutral to positive (dN/dS 0.5-1.2)Potential adaptation signals
Substrate-binding pocket0.6-0.8 (moderate)Mosaic patternReflects species-specific substrate adaptation

These evolutionary insights not only contribute to our understanding of bacterial evolution but also have practical implications for drug development, highlighting conserved targets for broad-spectrum activity versus variable regions that might enable species-specific targeting.

How might CRISPR-based approaches be used to study lspA function in B. mallei?

CRISPR-based technologies offer powerful new approaches to study lspA function in B. mallei, enabling precise genetic manipulation that was previously challenging in this organism. These methods can help address fundamental questions about lspA's role in bacterial physiology and pathogenesis.

CRISPR-Based Methodological Approaches:

  • CRISPRi for Conditional Knockdown:

    • Design of guide RNAs targeting lspA promoter or non-catalytic regions

    • Use of catalytically inactive Cas9 (dCas9) fused to repressors

    • Titration of knockdown levels using inducible promoters

    • Temporal control to study lspA depletion effects at different growth stages

  • CRISPR-Cas9 for Precise Genome Editing:

    • Introduction of point mutations in catalytic residues

    • Creation of domain swaps with other bacterial lspA genes

    • Integration of reporter tags for protein localization studies

    • Development of conditional alleles through insertion of inducible elements

  • CRISPR-Based Transcriptional Reporters:

    • Monitoring lspA expression under various conditions

    • Multiplexed analysis with lipoprotein substrate genes

    • Single-cell resolution of expression patterns during infection

Implementation Considerations:

When applying CRISPR technologies to B. mallei research, several special considerations apply:

  • Delivery methods optimized for Burkholderia species (electroporation protocols, specialized vectors)

  • Selection of appropriate Cas variants with demonstrated activity in Burkholderia

  • Biosafety procedures compatible with required containment levels

  • Validation strategies to confirm editing efficiency

Experimental Design Framework:

CRISPR ApplicationResearch QuestionExperimental ApproachExpected Outcome
CRISPRiIs lspA essential in all growth conditions?Titratable knockdown under various nutrient conditionsIdentification of conditional essentiality
Base editingHow do specific catalytic residues contribute to function?Targeted mutation of active site residuesStructure-function relationships
CRISPR interference screensWhich lipoproteins processed by lspA are most critical?Multiplex CRISPRi targeting predicted lipoprotein substratesPrioritization of key substrates
CRISPRaDoes overexpression affect membrane homeostasis?Activation of lspA expressionIdentification of rate-limiting steps in lipoprotein processing

These CRISPR-based approaches offer unprecedented precision in studying lspA function and can overcome many limitations of traditional genetic methods when working with challenging organisms like B. mallei.

What are the emerging opportunities for using recombinant lspA in synthetic biology applications?

Recombinant lspA presents intriguing opportunities in synthetic biology applications, extending beyond its traditional role in understanding bacterial pathogenesis. Novel applications are emerging that leverage this enzyme's unique capabilities in bioengineering contexts.

Innovative Synthetic Biology Applications:

  • Engineered Membrane Protein Display Systems:

    • Development of controllable surface display platforms

    • Creation of artificial lipoproteins with novel functions

    • Design of stimulus-responsive membrane anchoring systems

  • Cell-Free Protein Engineering:

    • Integration of lspA in cell-free protein synthesis systems

    • Production of lipidated proteins with enhanced stability

    • Development of high-throughput screening platforms for enzyme engineering

  • Biosensor Development:

    • Creation of FRET-based biosensors utilizing lspA processing

    • Design of whole-cell biosensors with lipoprotein reporters

    • Development of diagnostic tools for detecting specific molecular signatures

Implementation Strategies:

To leverage lspA in synthetic biology applications, several enabling technologies are required:

  • Enzyme Engineering Approaches:

    • Directed evolution for altered substrate specificity

    • Stability engineering for function in non-native environments

    • Fusion with orthogonal domains for new functionalities

  • Chassis Development:

    • Creation of minimal cell systems with defined lipoprotein processing

    • Engineering of non-pathogenic hosts with controlled lspA expression

    • Development of synthetic membranes compatible with lspA function

Potential Research Directions:

Application AreaKey InnovationTechnical ApproachPotential Impact
Vaccine developmentSurface display of antigensEngineered lspA-dependent anchoringEnhanced immunogenicity through lipidation
BiocatalysisMembrane-anchored enzyme cascadesCo-localization via lspA processingImproved reaction efficiency
Synthetic cellsDefined membrane protein incorporationControlled lipoprotein processingBottom-up assembly of functional membranes
Bioorthogonal chemistrySite-specific protein modificationlspA recognition sequence engineeringNovel protein conjugation methods

These emerging applications represent exciting frontiers in synthetic biology research, potentially transforming recombinant lspA from a subject of basic research into a valuable tool for biotechnology and bioengineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.