Recombinant Burkholderia mallei Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Burkholderia mallei Membrane Protein Insertase YidC (yidC) is a critical bacterial enzyme involved in the biogenesis of inner membrane proteins. As a member of the conserved YidC/Oxa1/Alb3 family, it facilitates membrane protein insertion, folding, and assembly, either independently or in concert with the Sec translocon . This recombinant variant, produced in Escherichia coli, retains structural and functional fidelity to its native counterpart, making it a valuable tool for studying membrane protein dynamics and bacterial pathogenesis .

Production and Characteristics

The recombinant YidC protein is engineered for high purity and stability, with the following specifications :

ParameterDetails
Expression SystemEscherichia coli
TagN-terminal His tag
Protein LengthFull-length (1–558 amino acids)
Molecular Weight~64 kDa (calculated based on amino acid sequence)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C
ReconstitutionSterile deionized water; glycerol (5–50%) recommended for long-term storage

Key Functional Partners:

  • YibN: A newly identified interactor that enhances YidC substrate insertion efficiency in vitro and in vivo .

  • Lipid Scramblase Activity: YidC thins the membrane bilayer, reducing energy costs for protein insertion .

Substrate Insertion Enhancement by YibN

Co-expression of YibN with YidC increases production of substrates like M13 procoat (1.5–1.8-fold) and SecG (2-fold). Mutations in SecG’s hydrophobic regions (e.g., I20E) diminish this effect, underscoring the role of transmembrane segment hydrophobicity .

In Vivo Complementation Assays

Alanine substitutions at T362 and Y517 render YidC nonfunctional, despite stable expression . This highlights the importance of electrostatic and aromatic interactions in the TM core.

Role in Burkholderia mallei Pathogenesis

While YidC itself is not a virulence factor, it is essential for biogenesis of virulence-associated membrane proteins (e.g., autotransporter BpaB) . BpaB facilitates biofilm formation and host cell adherence, processes critical for infection .

Applications and Implications

  1. Therapeutic Target: YidC’s role in virulence factor biogenesis positions it as a candidate for antimicrobial development .

  2. Structural Biology Tool: Recombinant YidC enables mechanistic studies of membrane protein insertion .

  3. Biotechnology: Used to express and purify challenging membrane proteins for industrial applications .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please clearly indicate your preferred format in the order notes, and we will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend brief centrifugation of the vial to ensure all contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our protein products is influenced by various factors including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to accommodate your specific tag type preferences. Please inform us if you have a specific tag type requirement, and we will prioritize its development.
Synonyms
yidC; BMA10229_A2241; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-558
Protein Length
full length protein
Species
Burkholderia mallei (strain NCTC 10229)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASNATNGNGASGASAAAA ANALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLAKLTLTKAGDGKQPDLS VTLFDHTANHTYLARTGLLGGDFPNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKV VKTYTFTRGSYVIGVDTKIENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQ KHFQKITFGDIDKNKADYVTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDPTLYRV GVKQPVEAIAPGQSADVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEK IHGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNA ALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFI LPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQ QYYITRTLGGAAAKKKAS
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins, both those that insert dependently and independently of the Sec translocase complex, as well as some lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of YidC protein and how does it contribute to its function?

YidC contains a distinctive arrangement of five conserved transmembrane domains with a helical hairpin between transmembrane segment 2 (TM2) and TM3 positioned on the cytoplasmic membrane surface. This structural arrangement creates a hydrophilic environment on the cytoplasmic side of the YidC transmembrane bundle that continues into a hydrophobic cluster of aromatic residues toward the periplasmic side . This design is critical for its function as it allows YidC to receive the polar termini and loops of substrate proteins during translocation initiation, facilitating their transfer across the hydrophobic core of the lipid bilayer . The specific organization enables YidC to interact with ribosomes at the tunnel exit while simultaneously providing an interface for membrane protein insertion at the protein-lipid boundary .

How does YidC differ from other membrane protein insertion machinery in bacteria?

Unlike the Sec translocon which forms a channel for protein translocation, YidC functions both independently as an insertase and in concert with the SecY complex. When operating alone, YidC serves as both an insertase and a lipid scramblase, specializing in the insertion of smaller membrane proteins while contributing to bilayer organization . This dual functionality distinguishes YidC from other insertases. The protein can induce significant thinning (7-10 Å) of the lipid bilayer due to hydrophobic mismatch between its transmembrane helices and the membrane, particularly near TM3 and TM5 . This membrane remodeling ability may facilitate the insertion of substrates by reducing the energetic barrier for translocation across the hydrophobic core of the membrane.

What are the optimal conditions for expressing and purifying recombinant Burkholderia mallei YidC?

For optimal expression and purification of recombinant B. mallei YidC, E. coli serves as an effective heterologous expression system when the protein is fused to an N-terminal His tag . Following expression, the protein should be extracted using a suitable detergent such as n-dodecyl-β-D-maltoside (DDM) to maintain its native conformation during purification . Purification via nickel affinity chromatography leverages the His tag, and should be followed by size exclusion chromatography to achieve high purity.

The purified protein should be stored in a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose . For long-term storage, it is recommended to add glycerol to a final concentration of 30-50% and store aliquots at -80°C to prevent repeated freeze-thaw cycles . When reconstituting the lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . The purity should exceed 90% as determined by SDS-PAGE analysis.

How can researchers effectively assess YidC-substrate interactions in vitro?

To assess YidC-substrate interactions in vitro, several complementary approaches are recommended:

  • Inverted membrane vesicle (INV) assays: Prepare INVs from bacterial strains expressing YidC and use them in translation/insertion assays with radiolabeled substrate proteins such as Pf3 coat, M13 procoat, or F0c . After incubation, perform proteinase K digestion to determine the amount of membrane-protected fragments as a measure of insertion efficiency.

  • Chemical cross-linking studies: Employ bifunctional cross-linkers to capture transient interactions between YidC and its substrates. This approach has successfully identified that YidC substrates cross-link specifically to TM3 and TM5 .

  • Blue-native PAGE analysis: Purify His-tagged YidC and potential interaction partners to homogeneity in detergent (e.g., DDM). Analyze the proteins by blue-native PAGE to visualize complex formation, as demonstrated with the YidC-YibN interaction .

  • Cryo-electron microscopy: For structural studies, use cryo-EM of translating YidC-ribosome complexes carrying specific YidC substrates to visualize the interaction at the ribosomal tunnel exit and the site for membrane protein insertion .

A comparative analysis approach using control INVs versus YidC-enriched INVs can quantify the stimulatory effect of YidC on substrate insertion, typically showing a 1.5-1.8-fold enhancement for known substrates .

What experimental approaches can be used to identify new YidC interaction partners?

To identify novel YidC interaction partners, researchers should employ multiple complementary strategies:

  • Proximity-dependent biotin labeling (BioID): This approach successfully identified YibN as a critical component within the YidC protein environment . The method involves fusing a biotin ligase (BirA) to YidC, allowing biotinylation of proximal proteins, which can then be isolated using streptavidin and identified by mass spectrometry.

  • Affinity purification-mass spectrometry: Conduct pull-down experiments using native membranes with tagged YidC, followed by mass spectrometric analysis to identify co-purifying proteins . This approach provides a comprehensive view of the YidC interactome.

  • On-gel binding assays with purified proteins: After identifying potential interactors, validate direct physical interactions using purified components analyzed by native gel electrophoresis. This method confirmed the YidC-YibN interaction and showed that the transmembrane segment of YibN (residues 1-29) is essential for complex formation .

  • Co-expression studies: Assess the functional significance of potential interactions by co-expressing YidC with candidate partners and measuring effects on substrate insertion efficiency. For example, co-expression of YibN enhanced the production and membrane insertion of various YidC substrates .

  • Genetic screens: Use suppressor or synthetic lethal screens to identify genes that functionally interact with YidC, potentially revealing new partners involved in membrane protein biogenesis.

How does YidC's lipid scramblase activity relate to its role in membrane protein insertion?

YidC exhibits dual functionality as both a membrane protein insertase and a lipid scramblase, with these activities being mechanistically interconnected . Recent studies indicate that lipid scrambling and bilayer reorganization are linked to membrane insertase activity . During membrane protein insertion, YidC induces significant thinning of the lipid bilayer (7-10 Å) due to hydrophobic mismatch between its transmembrane helices and the membrane . This thinning is most pronounced near TM3 and TM5, precisely where substrate proteins have been chemically cross-linked .

The lipid scramblase activity of YidC likely facilitates membrane protein insertion by:

  • Reducing the energetic barrier for translocation of charged residues across the hydrophobic core

  • Creating a more dynamic lipid environment that accommodates structural changes during insertion

  • Establishing a hydrophilic environment that receives the polar termini and loops of substrate proteins

Interestingly, the interaction partner YibN appears to interfere with YidC's lipid scramblase activity, as overproduction of YibN stimulates membrane lipid production and promotes inner membrane proliferation . This suggests a regulatory mechanism where YibN modulates YidC's dual functions to coordinate membrane protein insertion with lipid organization.

To investigate this relationship experimentally, researchers should:

  • Employ lipid mixing assays to measure scramblase activity directly

  • Create YidC variants with mutations that selectively affect one function

  • Monitor lipid composition changes during substrate insertion using mass spectrometry

  • Utilize molecular dynamics simulations to visualize lipid-protein interactions during insertion

What is the molecular mechanism of YidC-ribosome interaction during co-translational insertion?

The molecular mechanism of YidC-ribosome interaction during co-translational insertion involves specific contacts between YidC and the ribosomal tunnel exit that position the nascent chain for efficient membrane integration. Cryo-electron microscopy reconstructions of translating YidC-ribosome complexes carrying YidC substrates reveal that a single copy of YidC interacts with the ribosome at the tunnel exit .

The interaction occurs primarily through the cytoplasmic regions of YidC, particularly the helical hairpin between TM2 and TM3 that sits on the cytoplasmic membrane surface . This positioning allows YidC to receive the nascent chain as it emerges from the ribosomal tunnel and guide it toward the membrane insertion site at the YidC protein-lipid interface .

The mechanism likely proceeds through the following steps:

  • Initial docking of the ribosome to YidC via the helical hairpin

  • Transfer of the nascent chain from the ribosomal tunnel to the hydrophilic cavity of YidC

  • Lateral movement of transmembrane segments from YidC into the lipid bilayer

  • Thinning of the membrane near TM3 and TM5 to facilitate insertion of charged regions

  • Release of the inserted protein and detachment of the ribosome

This model aligns with structural data and explains the efficiency of co-translational insertion, as the nascent chain is directly guided from synthesis to insertion without exposure to the cytoplasm. The model also accounts for YidC's ability to function independently of the Sec translocon for certain substrates.

How does the functional relationship between YidC and YibN impact membrane protein biogenesis?

The recently discovered interaction between YidC and YibN has significant implications for membrane protein biogenesis. YibN, a 16 kDa single-pass inner membrane protein oriented towards the cytosol, physically associates with YidC through its transmembrane segment (residues 1-29) . This interaction enhances the functionality of YidC in several ways:

  • Enhanced substrate insertion: Co-expression studies and in vitro assays demonstrate that YibN enhances the production and membrane insertion of various YidC substrates, including M13 procoat, Pf3 phage coat proteins, ATP synthase subunit c, and SecG . In vitro translation/insertion assays using inverted membrane vesicles enriched for YibN showed a 1.5-1.8-fold stimulation of insertion efficiency compared to control vesicles .

  • Membrane remodeling: YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC's lipid scramblase activity . This leads to increased membrane surface area and the formation of circumvolutions and multilayered structures at the inner membrane .

  • Substrate-specific effects: The enhancement of insertion by YibN appears to be substrate-specific. For example, while YibN significantly improved insertion of wild-type SecG, it had much less effect on the SecG I20E mutant .

The functional relationship can be conceptualized as a regulatory mechanism where YibN modulates YidC activity to coordinate membrane protein insertion with lipid organization. This coordination may be particularly important during periods of membrane expansion or stress, where balanced protein and lipid synthesis is crucial for maintaining membrane integrity.

This relationship opens new research directions, including:

  • Investigating whether YibN expression levels change under different growth conditions

  • Determining if YibN-YidC interaction is regulated by cellular signals

  • Exploring whether other organisms possess YibN homologs with similar functions

  • Developing strategies to exploit this interaction for enhanced membrane protein production

How should researchers interpret contradictory results between in vivo and in vitro YidC insertion assays?

When faced with contradictory results between in vivo and in vitro YidC insertion assays, researchers should systematically evaluate several factors that might contribute to these discrepancies:

  • Membrane composition differences: In vitro systems typically use simplified lipid compositions that may lack key components present in native membranes. YidC's activity is sensitive to membrane thickness and composition, as evidenced by its ability to thin membranes by 7-10 Å near TM3 and TM5 . Consider using native membrane extracts or defined lipid mixtures that better mimic the bacterial inner membrane.

  • Presence of accessory factors: In vivo, YidC operates within a complex network of interacting proteins. The recent identification of YibN as a functional interactor that enhances YidC activity illustrates this complexity . In vitro systems may lack these accessory factors. Supplementing your in vitro assays with purified interaction partners like YibN could help reconcile contradictory results.

  • Energetic considerations: The proton motive force and ATP levels differ between in vivo and in vitro conditions. Some YidC-dependent insertion processes may require these energy sources, which might be depleted or absent in reconstituted systems.

  • Substrate folding kinetics: The temporal aspects of protein folding may differ significantly between the cellular environment and reconstituted systems. In vivo, co-translational insertion occurs as the nascent chain emerges from the ribosome, while in vitro assays often use fully synthesized proteins.

  • Quantification methods: Different detection methods (e.g., protease protection versus fluorescence-based assays) may measure different aspects of the insertion process, leading to apparently contradictory results.

To resolve these contradictions, consider the following approaches:

  • Compare results using multiple complementary assays

  • Systematically add components from the in vivo system to your in vitro assay until the discrepancy is resolved

  • Develop assays that can directly monitor the same parameter in both systems

  • Use genetic approaches (e.g., YidC variants) to identify specific determinants that might explain the differences

What analytical methods are most appropriate for quantifying YidC-mediated membrane thinning effects?

Quantifying YidC-mediated membrane thinning effects requires sophisticated analytical techniques that can measure membrane thickness with nanometer precision. The following methods are most appropriate:

TechniqueResolutionSample RequirementsKey AdvantagesLimitations
MD SimulationsAtomic (0.1 nm)Structural modelsDynamic information, atomic detailComputational cost, force field accuracy
AFM0.5-1 nm verticalSupported membranesDirect measurement, can map to protein structureMay perturb membrane, requires surface attachment
SAXS1-2 nmVesicle suspensionsWorks with native membranes, ensemble measurementLimited spatial resolution, model-dependent analysis
Neutron Reflectometry0.5-1 nmPlanar membranesExcellent vertical resolution, contrast variationComplex data analysis, specialized facilities
Fluorescence Techniques1-5 nmLabeled membranesCan be applied in vivo, dynamic informationRequires labeling, indirect measurement

For comprehensive analysis, combining multiple techniques is recommended, particularly pairing computational approaches (MD) with experimental validation (AFM or neutron reflectometry).

How can researchers differentiate between direct YidC-mediated insertion and YidC's influence on SecYEG-dependent insertion pathways?

Differentiating between direct YidC-mediated insertion and YidC's influence on SecYEG-dependent insertion pathways requires careful experimental design that can selectively monitor each pathway. The following approach is recommended:

  • Substrate selection strategy:

    • Use well-characterized substrates known to follow different insertion pathways:

      • M13 procoat and Pf3 coat proteins are inserted primarily by YidC alone

      • ATP synthase subunit c (F0c) can use both pathways

      • Multi-spanning membrane proteins typically require the SecYEG complex with YidC assistance

  • Reconstituted systems with defined components:

    • Prepare liposomes or nanodiscs containing:

      • YidC only

      • SecYEG only

      • YidC + SecYEG

      • Control (empty)

    • Compare insertion efficiency across these systems using purified substrate proteins

  • Crosslinking and interaction analysis:

    • Use site-specific crosslinkers to trap substrates interacting with either YidC or SecY

    • Employ pulse-chase experiments combined with immunoprecipitation to track substrate association with each machinery component over time

    • Blue-native PAGE can reveal the formation of different insertion complexes

  • Genetic approaches:

    • Use strains with conditional YidC expression or SecY depletion

    • Create YidC variants that specifically disrupt interaction with SecYEG

    • Engineer substrate variants with mutations that bias toward one pathway or the other

  • Quantitative and kinetic analysis:

    • Compare insertion kinetics with different machinery components

    • Measure thermodynamic parameters of insertion under various conditions

    • Use single-molecule techniques to observe individual insertion events

A typical experimental workflow would include:

Experimental PhaseDirect YidC PathwaySecYEG+YidC PathwayControl Experiments
PurificationIsolate YidC, substratesIsolate SecYEG, YidC, substratesPrepare mock systems
ReconstitutionYidC-only proteoliposomesSecYEG+YidC proteoliposomesEmpty liposomes, SecYEG-only
Insertion AssaysRadiolabeled substrates, protease protectionSame conditions as YidC-onlyMeasure in all systems
AnalysisQuantify insertion efficiency, kineticsCompare with YidC-only resultsStatistical analysis of differences
ValidationCrosslinking, microscopyCrosslinking, microscopySubstrate controls known to use specific pathways

The real power comes from comparative analysis: genuine YidC-only substrates should show high insertion efficiency in YidC-only systems and be minimally affected by SecYEG addition, while SecYEG-dependent substrates should show enhancement when both components are present compared to either alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.