Recombinant Burkholderia mallei Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
mtgA; BMA2493; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Burkholderia mallei (strain ATCC 23344)
Target Names
mtgA
Target Protein Sequence
MRNSPVSPGPGYAPARGSERARRRGVARWLAYVGGVFAGAWLATQLYYAVQIAMWSVFDP GSSAFMRADAWRLSNAQPATTIRHRWVPYDQIARTLKRAVIASEDADFANNSGYEVDAIL QAWEKNRARGRIVSGGSTITQQLARNLFLSGERSYIRKGQELIITWMLETLLDKERIFEI YLNSVEFGCGVYGAQAAAQYYYRIPASRLSAWQSARLAVMLPNPKYFDAHRGSPYLAQRA GVIARRMGAAELPASQ
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes the elongation of glycan chains from lipid-linked precursors.
Database Links

KEGG: bma:BMA2493

STRING: 243160.BMA2493

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and characterization of Burkholderia mallei mtgA?

Burkholderia mallei monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a key enzyme involved in bacterial cell wall synthesis. The protein (UniProt accession Q3V7M0) consists of 256 amino acids with the sequence beginning with MRNSPVSPGPGYAPARG and contains specific functional domains involved in peptidoglycan assembly . As a transglycosylase, mtgA catalyzes the polymerization of lipid II to form immature peptidoglycan strands in a reaction classified as EC 2.4.2.- . The gene is identified by the locus name BMA2493 in the B. mallei genome.

Research methods to determine structure typically include:

  • X-ray crystallography at resolutions of 1.5-3.0 Å

  • NMR spectroscopy for solution structure determination

  • Homology modeling using related bacterial transglycosylases as templates

  • Molecular dynamics simulations to assess functional conformations

How should recombinant B. mallei mtgA be stored and handled for optimal stability?

For optimal stability, recombinant B. mallei mtgA should be stored at -20°C in a Tris-based buffer with 50% glycerol . For long-term storage beyond 6 months, -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they lead to progressive denaturation and activity loss .

Methodology for preserving enzyme activity includes:

  • Dividing stock solutions into single-use aliquots (20-50 μL) before freezing

  • Using slow-thaw protocols (on ice) when retrieving frozen samples

  • Adding stabilizing agents such as glycerol (final concentration 20-50%)

  • Including reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) in working buffers

  • Maintaining pH between 7.0-8.0 depending on the specific application

What expression systems are most effective for producing recombinant B. mallei mtgA?

While specific expression systems for B. mallei mtgA are not directly mentioned in the search results, comparable recombinant proteins like Salmonella paratyphi B mtgA are successfully expressed in E. coli systems with His-tags for purification . For B. mallei proteins, several considerations are important:

  • Expression host selection:

    • E. coli BL21(DE3) or derivatives for high yield

    • Cell-free expression systems to avoid toxicity issues

    • Specialized hosts like Pseudomonas species for proper folding of Burkholderia proteins

  • Vector design considerations:

    • Inducible promoter systems (T7, tac, or rhamnose-inducible)

    • Fusion tags (His6, GST, MBP) to enhance solubility and facilitate purification

    • Codon optimization for the expression host

  • Culture conditions optimization:

    • Temperature reduction to 16-25°C during induction

    • Addition of compatible solutes (sorbitol, glycine betaine)

    • Supplementation with cofactors required for proper folding

What are the established enzymatic assay methods for measuring mtgA activity?

Activity assays for recombinant mtgA typically measure its transglycosylase function using techniques such as:

  • Fluorescent substrate assays:

    • Dansylated or fluorescamine-labeled lipid II substrates

    • Continuous monitoring of fluorescence changes (Ex: 340 nm, Em: 500 nm)

    • Reaction rates calculated from initial velocity measurements

  • HPLC-based assays:

    • Separation of substrate (lipid II) and products (peptidoglycan polymers)

    • Detection by UV absorbance (205-220 nm) or mass spectrometry

    • Quantification based on peak area integration

  • Radiolabeled substrate incorporation:

    • [14C]- or [3H]-labeled lipid II precursors

    • Quantification of radiolabeled peptidoglycan polymers

    • Analysis by scintillation counting after polymer isolation

How does mtgA contribute to B. mallei pathogenicity and virulence?

While direct evidence on mtgA's role in B. mallei virulence is limited in the search results, we can extrapolate from related research in Burkholderia species and other peptidoglycan-associated proteins:

Peptidoglycan biosynthesis enzymes like mtgA are critical for bacterial cell wall integrity, which directly impacts pathogen survival during infection. In B. mallei, cell wall components interact with host immune systems and contribute to pathogenicity. For example, the peptidoglycan-associated lipoprotein Pal has been shown to contribute significantly to B. mallei virulence, specifically in complement resistance and intracellular replication .

Research approaches to investigate mtgA's role in virulence include:

  • Gene knockout/knockdown studies:

    • Targeted mutagenesis to generate mtgA-deficient strains

    • Phenotypic characterization in infection models

    • Complementation studies to confirm specificity

  • Cellular infection models:

    • Macrophage survival assays (J774.1, RAW264.7 cell lines)

    • Assessment of intracellular replication rates

    • Measurement of host cytokine responses

  • Animal models:

    • BALB/c mice infection via aerosol or intranasal routes

    • Histopathological examination of infected tissues

    • Bacterial burden quantification in organs

What is the relationship between B. mallei mtgA and antibiotic resistance mechanisms?

As a peptidoglycan biosynthesis enzyme, mtgA represents a potential antibiotic target and may influence susceptibility to cell wall-targeting antibiotics. Research approaches to investigate this relationship include:

  • Inhibitor screening methodologies:

    • High-throughput screening of chemical libraries

    • Structure-based virtual screening

    • Fragment-based drug discovery approaches

  • Susceptibility testing protocols:

    • Minimum inhibitory concentration (MIC) determination using broth microdilution

    • Time-kill assays to assess bactericidal activity

    • Checkerboard assays to identify synergistic combinations

  • Resistance development studies:

    • Serial passage experiments in sub-inhibitory concentrations

    • Whole genome sequencing to identify compensatory mutations

    • Transcriptome analysis to detect resistance mechanisms

How can recombinant mtgA be utilized in structural biology studies to facilitate drug design?

Structural biology approaches for mtgA characterization to support drug design include:

  • Crystallization optimization techniques:

    • Systematic screening of precipitants, pH, and additives

    • Surface entropy reduction mutations to enhance crystal packing

    • In situ proteolysis to remove flexible regions

  • Structure determination workflows:

    • X-ray diffraction data collection strategies (wavelength, exposure time)

    • Molecular replacement using homologous structures

    • Refinement protocols to maximize model accuracy

  • Structure-based drug design approaches:

    • Active site mapping and hotspot identification

    • Molecular docking of virtual compound libraries

    • Fragment-based screening using thermal shift assays

What are the optimal conditions for performing enzyme kinetic studies on B. mallei mtgA?

For comprehensive enzyme kinetic characterization:

  • Reaction buffer optimization:

    • pH range testing (typically pH 6.5-8.5)

    • Divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺) at 1-10 mM

    • Ionic strength adjustment (50-200 mM NaCl or KCl)

  • Substrate concentration determination:

    • Km measurement using substrate range spanning 0.1-10× expected Km

    • Lipid II concentrations typically from 1-100 μM

    • Consideration of substrate solubility limitations

  • Data analysis approaches:

    • Michaelis-Menten, Lineweaver-Burk, or Eadie-Hofstee plots

    • Global fitting using non-linear regression

    • Evaluation of inhibition mechanisms (competitive, non-competitive)

How does B. mallei mtgA compare with orthologs from other bacterial pathogens?

Comparative analysis methodologies include:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment using MUSCLE or CLUSTAL algorithms

    • Construction of phylogenetic trees using maximum likelihood methods

    • Conservation analysis of catalytic residues

  • Functional comparison approaches:

    • Activity assays under standardized conditions

    • Substrate specificity profiling

    • Inhibitor sensitivity patterns

  • Structural comparison techniques:

    • Superposition of crystal structures or homology models

    • Active site architecture analysis

    • Molecular dynamics simulation of conformational differences

OrganismProtein Identity (%)Key Structural DifferencesSubstrate SpecificityReference
B. mallei100 (reference)Reference structureGram-negative peptidoglycan precursors
B. cenocepacia~75-85 (estimated)Variations in binding pocketSimilar to B. mallei
S. paratyphi B~40-50 (estimated)Differences in C-terminal domainEnterobacteriaceae-specific lipid II
E. coli~45 (estimated)More open active siteBroader substrate tolerance-

What are the key considerations for designing inhibitor screening assays for B. mallei mtgA?

  • Primary screening methodologies:

    • Fluorescence-based high-throughput assays

    • Thermal shift assays to detect ligand binding

    • In silico screening followed by biochemical validation

  • Counter-screening strategies:

    • Selectivity assays against human homologs

    • Cytotoxicity assessment in mammalian cell lines

    • Specificity testing against related bacterial enzymes

  • Validation approaches:

    • Determination of IC50 and Ki values

    • Mode of inhibition studies

    • X-ray crystallography of enzyme-inhibitor complexes

How can researchers troubleshoot issues with recombinant B. mallei mtgA expression and purification?

  • Expression troubleshooting:

    • Optimization of induction conditions (temperature, inducer concentration)

    • Evaluation of different fusion tags (His, GST, MBP)

    • Testing of specialized expression strains (Rosetta, Arctic Express)

  • Solubility enhancement strategies:

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Addition of solubility enhancers to lysis buffer (glycerol, detergents)

    • Refolding protocols from inclusion bodies

  • Purification optimization:

    • Multi-step purification approaches (IMAC followed by ion exchange)

    • On-column refolding techniques

    • Size exclusion chromatography for final polishing

How can B. mallei mtgA be utilized in vaccine development research?

Based on success with other B. mallei proteins like Pal , mtgA could potentially serve as a vaccine component. Research approaches include:

  • Immunogenicity assessment:

    • T-cell epitope prediction and validation

    • B-cell epitope mapping

    • Measurement of antibody responses in animal models

  • Delivery system development:

    • Viral vector systems (like Parainfluenza Virus 5 used for Pal )

    • Adjuvant formulation optimization

    • Prime-boost vaccination strategies

  • Protection evaluation:

    • Challenge studies in appropriate animal models

    • Correlates of protection determination

    • Combination with other B. mallei antigens

What approaches are effective for studying mtgA interactions with other components of the cell wall synthesis machinery?

  • Protein-protein interaction methods:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Surface plasmon resonance for binding kinetics

  • In situ localization techniques:

    • Fluorescent protein fusions for live-cell imaging

    • Immunogold electron microscopy for ultrastructural analysis

    • Super-resolution microscopy (STORM, PALM)

  • Functional complex reconstitution:

    • In vitro reconstruction of minimal peptidoglycan synthesis machinery

    • Liposome-based assays to mimic membrane environment

    • Single-molecule techniques to observe complex dynamics

How might targeted inhibition of B. mallei mtgA contribute to novel therapeutic strategies?

  • Antimicrobial development potential:

    • Rational design of specific inhibitors based on structural information

    • Repurposing of existing transglycosylase inhibitors (moenomycin derivatives)

    • Development of peptidomimetics targeting the active site

  • Combination therapy approaches:

    • Synergistic effects with existing antibiotics

    • Multi-target strategies to minimize resistance development

    • Host-directed therapies combined with mtgA inhibition

  • Delivery system considerations:

    • Nanoparticle formulations for improved penetration

    • Prodrug approaches to enhance cellular uptake

    • Targeted delivery to infection sites

What emerging technologies are advancing research on bacterial transglycosylases like mtgA?

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane-associated complexes

    • Micro-electron diffraction for microcrystals

    • Time-resolved crystallography for reaction intermediates

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics)

    • Metabolic flux analysis of peptidoglycan precursors

    • Network modeling of cell wall biosynthesis

  • Novel screening methodologies:

    • CRISPR-based genetic screens

    • Phenotypic screening with machine learning analysis

    • Microfluidic platforms for single-cell analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.