Recombinant Burkholderia mallei NADH-quinone oxidoreductase subunit A (nuoA)

What is NADH-quinone oxidoreductase and what role does the nuoA subunit play?

NADH-quinone oxidoreductase (EC 1.6.99.3) is the largest and least understood enzyme complex of the respiratory chain, playing a critical role in energy metabolism . In prokaryotes like Burkholderia mallei, this complex (also known as NDH-1) contains 14 subunits compared to the 40+ subunits found in mammalian mitochondrial complex I .

Research methodology: To study nuoA's specific contribution, researchers typically employ comparative genomics, site-directed mutagenesis, and reconstitution experiments using purified recombinant components. Electron transport assays measuring NADH oxidation rates can quantify functional impacts of nuoA mutations.

How does the structure of B. mallei nuoA compare to homologous proteins in other bacterial species?

The nuoA protein from Burkholderia mallei has a primary structure of 119 amino acids, with the sequence: MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE .

Comparative analysis with homologous proteins in related Burkholderia species shows significant conservation, particularly within the B. pseudomallei-near neighbor group . This conservation extends to hydrophobic transmembrane domains, which are characteristic of membrane-integrated subunits of respiratory chain complexes .

Research methodology: Sequence alignment tools (BLAST, Clustal Omega) should be used to compare nuoA across species, followed by hydropathy plot analysis to identify transmembrane regions. Homology modeling based on solved structures of related proteins can provide structural insights in the absence of crystal structures.

What experimental approaches are most effective for studying the functional role of nuoA in electron transport?

The functional role of nuoA in electron transport can be studied through multiple complementary approaches:

The most comprehensive approach combines these methods with structural studies. Techniques like photo-affinity labeling with inhibitors (similar to that used for the PSST subunit) can help identify functional domains within nuoA that participate in electron transfer or complex assembly .

How does nuoA contribute to the inhibitor sensitivity of the NADH-quinone oxidoreductase complex?

While the PSST subunit has been identified as a primary binding site for various inhibitors like rotenone and piericidin A , the role of nuoA in inhibitor sensitivity is less characterized. Based on structural models of complex I, nuoA's membrane location suggests it may influence inhibitor access to binding sites or contribute to conformational changes that affect inhibitor binding.

Research methodology: Comparative inhibition studies between wild-type and nuoA-mutated complexes can reveal its contribution to inhibitor sensitivity. Photo-affinity labeling using radiolabeled inhibitors like (trifluoromethyl)diazirinyl[3H]pyridaben ([3H]TDP) could determine if nuoA directly participates in inhibitor binding . IC50 curves for various inhibitors should be generated and analyzed using enzyme kinetics models.

What is the relationship between B. mallei nuoA and virulence/pathogenicity?

As a component of the essential respiratory chain in B. mallei, nuoA likely contributes to the organism's energy metabolism, which is crucial for survival in host environments. B. mallei is closely related to B. pseudomallei, the causative agent of melioidosis, suggesting potential roles in pathogenicity .

Research methodology: To investigate this relationship, researchers should employ gene knockout or knockdown approaches to create nuoA-deficient mutants, followed by virulence assays in appropriate infection models. Comparative studies with related pathogens like B. pseudomallei could provide insights into conserved mechanisms. Transcriptomic analysis under host-mimicking conditions might reveal expression patterns that correlate with virulence factors.

What are the optimal conditions for recombinant expression and purification of B. mallei nuoA?

Optimal expression and purification of B. mallei nuoA involves several critical considerations:

• Expression system: E. coli has been successfully used for nuoA expression with N-terminal His-tags . BL21(DE3) or similar strains are recommended for membrane protein expression.

• Expression conditions:

  • Induction: 0.1-0.5 mM IPTG at mid-log phase (OD600 ~0.6)

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Duration: 4-16 hours depending on temperature

• Purification strategy:

  • Cell lysis: Mechanical disruption (sonication or French press) in buffer containing detergents

  • Detergent selection: Mild detergents (DDM, LDAO) preserve structure

  • IMAC purification: Using the His-tag for initial capture

  • Size exclusion chromatography: For final polishing and buffer exchange

• Quality control:

  • SDS-PAGE: To verify purity (>90% is achievable)

  • Western blot: To confirm identity

  • Mass spectrometry: For sequence verification

The recombinant protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability.

What techniques can be used to study the interaction between nuoA and other subunits of the NADH-quinone oxidoreductase complex?

Several complementary techniques can elucidate nuoA's interactions with other complex I subunits:

• Co-immunoprecipitation: Using antibodies against tagged nuoA to pull down interacting partners.

• Crosslinking: Chemical crosslinkers of varying lengths can capture transient interactions, followed by mass spectrometry identification.

• Bacterial two-hybrid systems: Modified for membrane proteins to detect binary interactions.

• Blue native PAGE: To analyze intact complexes and subcomplexes.

• Cryo-electron microscopy: For structural determination of the entire complex with subunit resolution.

• Proteoliposome reconstitution: To study functional interactions in a controlled membrane environment.

Research methodology: Begin with simpler techniques like co-immunoprecipitation to establish primary interactions, then progress to more complex methods. Validation through multiple techniques is essential for confident mapping of the interaction network.

How can researchers distinguish between the effects of nuoA mutations on complex assembly versus direct catalytic function?

Distinguishing between assembly and catalytic defects requires a systematic approach:

• Analysis of complex integrity:

  • Blue native PAGE to assess complex formation

  • Sucrose gradient centrifugation to analyze subcomplex distribution

  • Immunodetection of multiple subunits to track assembly status

• Functional assays:

  • NADH:ubiquinone oxidoreductase activity measurements

  • Specific electron transfer steps using artificial electron acceptors

  • Proton pumping assays

• Structural analysis:

  • Crosslinking patterns of mutants versus wild-type

  • Accessibility of specific residues or domains

  • Thermal stability assays to detect structural perturbations

Research methodology: Implement a decision tree approach where assembly is assessed first. If assembly defects are detected, interpret functional data in that context. If assembly appears normal, functional defects can be attributed to direct catalytic roles. Control experiments with known assembly-defective mutants should be included for comparison.

How can insights from B. mallei nuoA research contribute to understanding related pathogens and potential therapeutic targets?

Research on B. mallei nuoA has broader implications for understanding related pathogens, particularly within the Burkholderia genus which contains over 60 species inhabiting diverse environments including soil, plants, water, animals, and humans . The respiratory chain is an essential metabolic component and potential drug target in these organisms.

Key applications include:

• Comparative genomics: Identification of conserved features across pathogens like B. pseudomallei (melioidosis) and other Burkholderia species .

• Therapeutic development: The respiratory chain is a validated drug target in other pathogens. Understanding nuoA's role could reveal species-specific inhibition strategies.

• Diagnostic development: The recA sequencing technique used for Burkholderia classification could be expanded to include nuoA as a marker for species identification.

• Evolution of respiratory complexes: Comparative studies inform understanding of respiratory chain evolution across species.

Research methodology: Implement phylogenetic analyses of nuoA sequences across Burkholderia species, combined with functional assays in representative organisms. Drug screening platforms targeting conserved features could identify lead compounds for therapeutic development.

What are the most critical factors for maintaining stability and activity of purified recombinant nuoA protein?

Maintaining stability and activity of purified recombinant nuoA requires attention to several factors:

• Buffer composition:

  • Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizer

  • Addition of glycerol (10-20%) can further enhance stability

  • Detergent concentration must be maintained above CMC but minimized

• Storage conditions:

  • Store at -20°C/-80°C for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

• Reconstitution protocols:

  • Lyophilized protein should be reconstituted in deionized sterile water

  • Centrifuge vials briefly before opening to bring contents to the bottom

• Functional preservation:

  • Consider reconstitution into liposomes or nanodiscs for functional studies

  • Inclusion of physiological lipids can enhance activity

  • Addition of respiratory chain components may stabilize the protein

Research methodology: Implement thermal shift assays and activity measurements over time to assess stability under various conditions. Optimize formulation through systematic testing of buffers, additives, and storage protocols.

How can researchers integrate structural and functional data to develop a comprehensive model of nuoA's role in the NADH-quinone oxidoreductase complex?

Developing a comprehensive model of nuoA's role requires integration of multiple data types:

• Structural data integration:

  • Homology models based on related complexes

  • Cryo-EM data of whole complexes

  • Crosslinking distance constraints

  • Molecular dynamics simulations

• Functional data integration:

  • Mutational analyses mapped onto structural models

  • Inhibitor binding studies

  • Electron transfer pathways

  • Proton translocation measurements

• Evolutionary analysis:

  • Conservation patterns across species

  • Co-evolution of interacting residues

  • Adaptation to different environmental niches

Research methodology: Use integrative modeling approaches that combine constraints from multiple experimental sources. Molecular dynamics simulations can test mechanistic hypotheses derived from static structural models. Machine learning approaches can help identify patterns in complex datasets that inform the functional model.

What are the challenges and solutions for studying nuoA interactions with inhibitors compared to other subunits like PSST?

Studying nuoA interactions with inhibitors faces several challenges compared to well-characterized subunits like PSST:

Research methodology: Implement competitive binding assays using radiolabeled inhibitors with purified components. Surface plasmon resonance or isothermal titration calorimetry can provide binding kinetics. Photoaffinity labeling with (trifluoromethyl)diazirinyl[3H]pyridaben or similar probes could identify direct interactions .