Recombinant Burkholderia mallei NADH-quinone oxidoreductase subunit K (nuoK)

What is Burkholderia mallei NADH-quinone oxidoreductase subunit K (nuoK)?

Burkholderia mallei NADH-quinone oxidoreductase subunit K (nuoK) is a 101-amino acid membrane protein that functions as a component of the bacterial respiratory chain complex I. The protein has a molecular function in transferring electrons from NADH to quinone, contributing to energy metabolism in this pathogen. As described in the UniProt database (ID: A1V2M6), nuoK is also known as "NADH dehydrogenase I subunit K" or "NDH-1 subunit K" . The full amino acid sequence is: MLTLAHYLVLGAILFAIAIVGIFLNRRNIIIILMAIELMLLAVNTNFVAFSHYLGDVHGQIFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG .

What is the biological significance of nuoK in B. mallei metabolism?

NuoK serves as a critical component of the NADH-quinone oxidoreductase complex, which catalyzes the transfer of electrons from NADH to quinone through protein-bound prosthetic groups. This complex is essential for energy conservation in cellular respiration and is part of the proton-translocating mechanism . While the specific role of nuoK isn't fully characterized, evidence from homologous systems suggests it may participate in the terminal electron transfer step from iron-sulfur cluster N2 to quinone . This function is critical for maintaining the proton gradient across the membrane, which drives ATP synthesis and supports the metabolic needs of the bacterium during infection.

How is recombinant B. mallei nuoK typically expressed and purified?

Recombinant full-length B. mallei nuoK can be successfully expressed in E. coli expression systems with an N-terminal His-tag . The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The purification protocol generally includes:

• Expression in E. coli with appropriate induction parameters

• Cell lysis under conditions that preserve membrane protein integrity

• Affinity chromatography using the His-tag for selective purification

• Buffer exchange to remove imidazole and other contaminants

• Quality control via SDS-PAGE to confirm >90% purity

For long-term storage, adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended to maintain protein stability and function .

What expression systems are most efficient for producing recombinant B. mallei nuoK?

Since nuoK is a relatively small membrane protein (101 amino acids), it may express reasonably well in standard systems, but optimization of temperature, inducer concentration, and expression duration is critical for maximizing yield and maintaining proper folding.

How can researchers validate the structural integrity of purified recombinant nuoK?

Validating the structural integrity of recombinant B. mallei nuoK requires a multi-faceted approach:

• SDS-PAGE analysis to confirm molecular weight and purity >90%

• Western blotting with anti-His antibodies to verify the presence of the tag

• Circular dichroism (CD) spectroscopy to assess secondary structure elements expected in membrane proteins

• Limited proteolysis to evaluate proper folding (properly folded proteins often show characteristic digestion patterns)

• Size exclusion chromatography to assess oligomeric state

• Functional assays measuring electron transfer capacity (if reconstituted with other complex components)

For membrane proteins like nuoK, detergent screening is also critical to identify conditions that maintain native-like structure after extraction from the membrane environment.

What functional assays can be used to evaluate recombinant B. mallei nuoK activity?

• NADH oxidation assays using artificial electron acceptors to bypass the need for the complete complex

• Inhibitor binding studies using known Complex I inhibitors like rotenone, piericidin A, bullatacin, and pyridaben

• Reconstitution experiments with other NADH-quinone oxidoreductase subunits to assess complex formation and activity

• Liposome reconstitution to measure proton pumping capability

• Electron paramagnetic resonance (EPR) spectroscopy to monitor changes in iron-sulfur clusters during electron transfer

When analyzing activity, it's important to account for the hydrophobic nature of nuoK and ensure appropriate detergent conditions that maintain functionality while allowing experimental accessibility.

How do mutations in nuoK affect electron transport in B. mallei?

Since nuoK is proposed to be involved in the terminal electron transfer step from iron-sulfur clusters to quinone, mutations would likely disrupt this critical energy-generating pathway. The PSST subunit in mammalian Complex I (homologous to bacterial NQO6) has been identified as the binding site for several potent inhibitors, suggesting its importance in quinone interaction . By extension, B. mallei nuoK likely plays a similar role.

Experimental approaches to investigate mutation effects include:

• Site-directed mutagenesis targeting conserved residues

• Complementation studies in nuoK knockout strains

• Comparative growth analysis under different metabolic conditions

• Measurement of membrane potential in wild-type versus mutant strains

• Assessment of virulence in cellular and animal infection models

Understanding the functional consequences of nuoK mutations could identify critical residues involved in electron transport and potentially reveal new targets for antimicrobial development.

Can recombinant B. mallei nuoK be used for developing diagnostic tools for glanders?

Developing diagnostics for glanders faces significant challenges due to cross-reactivity with B. pseudomallei . While the search results don't specifically address nuoK as a diagnostic target, several factors would need evaluation:

• Immunogenicity: Whether nuoK elicits a detectable antibody response during natural infection

• Specificity: Analysis of sequence divergence between B. mallei nuoK and homologs in B. pseudomallei and other Burkholderia species

• Accessibility: Whether antibodies can access this membrane protein during infection

Previous research has identified recombinant proteins for serodiagnosis of glanders, with efforts focused on identifying B. mallei-specific diagnostic antigens . Integration of nuoK into a multiprotein diagnostic panel might improve detection specificity compared to single-antigen approaches.

How does the structure of B. mallei nuoK compare to homologous proteins in related species?

B. mallei is considered a deletion clone of B. pseudomallei, with retained genes sharing approximately 99.5% DNA sequence identity with their B. pseudomallei orthologs . Given this high genetic similarity, nuoK likely maintains considerable structural conservation between these species.

The NADH-quinone oxidoreductase complex in bacteria like Paracoccus denitrificans and Thermus thermophilus contains 14 subunits, which are homologous to components of the mammalian complex I . The bacterial NQO6 subunit (homologous to mammalian PSST) has been identified as involved in electron transfer to quinone .

Structural analysis would require:

• Sequence alignment of nuoK across Burkholderia species

• Homology modeling based on resolved structures of bacterial complex I components

• Identification of conserved motifs involved in quinone binding and electron transfer

• Analysis of membrane-spanning regions and protein-protein interaction domains

Such comparative analysis could reveal species-specific structural features with potential applications in selective targeting of B. mallei.

What is the potential of B. mallei nuoK as a vaccine target?

• A B. mallei tonB mutant (TMM001) deficient in iron acquisition showed promise as a potential backbone strain for vaccine development, providing protection against both B. mallei and B. pseudomallei in mouse models

• At 21 days post-immunization with TMM001, mice developed significantly higher levels of B. mallei-specific IgG1, IgG2a, and IgM compared to controls

• TMM001-treated mice showed reduced inflammatory cytokines and less severe pathological damage to target organs following challenge

For nuoK to be considered as a vaccine target, researchers would need to evaluate:

• Surface accessibility of relevant epitopes

• Conservation across clinical isolates

• Ability to elicit protective rather than just reactive immunity

• Stability and manufacturability as a recombinant antigen

How could inhibitors targeting nuoK be developed as potential therapeutics?

The development of nuoK inhibitors would build on knowledge of Complex I inhibition. Several compounds have been identified that inhibit NADH-quinone oxidoreductase, including rotenone, piericidin A, bullatacin, and pyridaben . These inhibitors target the terminal electron transfer region, which likely involves nuoK.

A systematic approach would include:

• High-throughput screening against recombinant nuoK or reconstituted subcomplexes

• Structure-activity relationship studies of identified hits

• Molecular modeling to optimize binding specificity for the bacterial versus mammalian homolog

• Assessment of bacterial membrane permeability

• Evaluation of cytotoxicity and pharmacokinetic properties

Given that B. mallei is classified as a Tier 1 Select Agent with bioterrorism potential , development of novel therapeutics has both public health and biosecurity implications.

What cross-protection potential exists between B. mallei and B. pseudomallei based on nuoK conservation?

Cross-protection strategies are particularly relevant for Burkholderia species due to their genetic similarity and the challenges in developing species-specific vaccines. Evidence supporting potential cross-protection includes:

• B. mallei is essentially a deletion clone of B. pseudomallei, with retained genes sharing ~99.5% sequence identity

• A B. mallei tonB mutant provided significant protection against challenge with B. pseudomallei in a cross-protection study of acute inhalational melioidosis

• The high genetic similarity suggests conserved epitopes between nuoK from both species

For evaluating nuoK-based cross-protection, researchers should:

• Compare sequences and epitope predictions between species

• Assess cross-reactivity of antibodies raised against one species' nuoK with the other

• Determine whether T-cell responses show cross-recognition

• Evaluate protection in animal models using heterologous challenge

If conserved protective epitopes are identified, a single immunogen might provide protection against both pathogens, which would be valuable given their similar clinical presentations and treatment approaches.

What are the main challenges in working with recombinant B. mallei proteins?

Working with B. mallei proteins presents several significant challenges:

• Biosafety concerns: B. mallei is classified as a Tier 1 Select Agent requiring BSL-3 containment

• Genetic manipulation limitations: Limited approved selection markers for B. mallei genetic manipulation (kanamycin, zeocin, polymyxin B)

• Cross-reactivity with B. pseudomallei: High genetic similarity (~99.5%) complicates specific detection

• Membrane protein expression: Hydrophobic proteins like nuoK often express poorly or aggregate

Methodological solutions include:

• Working with recombinant proteins in non-pathogenic expression systems

• Using site-specific recombinase systems for marker recycling

• Careful selection of unique epitopes or regions for antibody generation

• Optimization of detergent conditions for membrane protein solubilization and stabilization

How can researchers optimize storage conditions for recombinant B. mallei nuoK?

Proper storage is crucial for maintaining the integrity and activity of recombinant nuoK. Based on available information:

• Short-term storage: Working aliquots can be maintained at 4°C for up to one week

• Long-term storage: Store at -20°C/-80°C with 5-50% glycerol added as a cryoprotectant

• Lyophilization: The protein can be supplied as a lyophilized powder for maximum stability

• Reconstitution: Use deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Handling: Avoid repeated freeze-thaw cycles which can lead to protein denaturation

For membrane proteins like nuoK, addition of appropriate detergents or lipids may help maintain native-like structure during storage. Stability studies using techniques like differential scanning fluorimetry can help optimize buffer conditions for maximum shelf-life.

What are the most promising research avenues involving B. mallei nuoK?

Based on current knowledge, several research directions show particular promise:

• Structural characterization: Resolving the structure of nuoK and its interactions within the respiratory complex could reveal novel features for therapeutic targeting

• Cross-species comparisons: Detailed comparative analysis with B. pseudomallei homologs could identify unique features for species-specific diagnostics

• Inhibitor development: Screening for nuoK-specific inhibitors could lead to novel antimicrobials against this challenging pathogen

• Immunological profiling: Characterizing the immune response to nuoK during infection could inform vaccine development

• Systems biology approaches: Integrating nuoK function into metabolic models of B. mallei to predict vulnerabilities

Advanced research on B. mallei nuoK has implications beyond this specific pathogen, potentially informing our understanding of respiratory chain components across the Burkholderia genus and other bacterial pathogens.

How might emerging technologies enhance research on recombinant B. mallei nuoK?

Emerging technologies offer new approaches to overcome traditional challenges in studying membrane proteins like nuoK:

• Cryo-electron microscopy: Enables structural determination without crystallization

• Nanodiscs and membrane scaffolding proteins: Provide native-like membrane environments for functional studies

• CRISPR-Cas9 genome editing: Facilitates precise genetic manipulation in Burkholderia species

• Single-cell techniques: Allow assessment of nuoK function in heterogeneous bacterial populations

• AI-based structural prediction: Tools like AlphaFold2 can predict protein structures with increasing accuracy