Recombinant Burkholderia mallei Probable intracellular septation protein A (BMA1442)

What is BMA1442 and what is its basic structure?

BMA1442 (UniProt ID: Q62JM5) is a probable intracellular septation protein A in Burkholderia mallei, also known as yciB or Inner membrane-spanning protein YciB. It is a small, highly hydrophobic protein consisting of 176 amino acids. The amino acid sequence is: MKFLFDLFPIILFFAAFKLWGIFTATAVAIAATLAQVAWVAFRHRKVDTMLWVSLGVIVVFGGATLVLHDEKFIQWKPTVLYWLFAVGLVAARYAFGKNLIEKMMGKQLTLPEPVWDKLNLAWAAFFAALGVTNLYVVRNFTESQWVNFKLFGTTGAIVVFVILQSLWLAKYLKEE . Based on homology with similar septation proteins in other bacteria, it likely contains multiple transmembrane domains and functions as an integral membrane protein involved in cell division processes.

How does BMA1442 relate to bacterial cell division?

While direct experimental evidence for BMA1442's function is limited, homologous proteins like ispA in Shigella flexneri have been extensively characterized. When ispA is mutated in S. flexneri, bacteria develop significant defects in cell division, forming long filamentous structures without proper septa, eventually becoming trapped within host cells . By extrapolation, BMA1442 likely plays a critical role in the septation process during B. mallei cell division, particularly when the bacterium is replicating intracellularly. This function appears essential for maintaining normal bacterial morphology and successful intracellular replication during infection.

Where is BMA1442 localized in the bacterial cell?

Based on its amino acid sequence, hydrophobicity profile, and comparison with homologous proteins, BMA1442 is predicted to be an inner membrane protein with multiple transmembrane domains . This localization is consistent with its putative role in septation and cell division, as these processes require protein machinery anchored at the cytoplasmic membrane to coordinate the inward growth of peptidoglycan and membrane components during bacterial cytokinesis.

What expression systems are optimal for producing recombinant BMA1442?

Recombinant BMA1442 can be successfully expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The commercially available recombinant protein utilizes this approach to produce the full-length protein (amino acids 1-176). When designing expression constructs, researchers should consider:

• Codon optimization for E. coli expression

• Inclusion of appropriate affinity tags (His-tag is commonly used)

• Selection of expression vectors with inducible promoters

• Growth conditions optimized for membrane protein expression (lower temperatures of 16-25°C after induction)

The hydrophobic nature of BMA1442 may present challenges for soluble expression, potentially requiring specialized approaches for membrane protein production.

What are the recommended storage and handling protocols for recombinant BMA1442?

Based on available data, the following protocols are recommended for optimal protein stability and activity:

Prior to opening, vials should be briefly centrifuged to bring contents to the bottom . For experimental work, understanding the protein's hydrophobic nature is critical for designing appropriate assay conditions.

What functional assays can be used to study BMA1442 activity?

Several approaches can be employed to assess BMA1442 function:

• Bacterial filamentation assays: Complementation studies using BMA1442 in ispA-deficient bacterial strains can demonstrate functional restoration of proper septation. Microscopic examination can quantify bacterial morphology and septum formation.

• Intracellular replication assays: Using macrophage or epithelial cell infection models to compare wild-type and BMA1442-mutant B. mallei strains can reveal its importance in intracellular survival and replication.

• Protein-protein interaction studies: Pull-down assays using His-tagged BMA1442 to identify binding partners within the bacterial divisome complex.

• Membrane localization studies: Fractionation experiments followed by Western blotting to confirm membrane localization, or fluorescent fusion proteins to visualize localization in live bacteria.

Based on studies of the homologous ispA gene in Shigella, cell-based assays examining actin polymerization and bacterial spread through cell monolayers may also provide insights into BMA1442 function .

How does BMA1442 contribute to B. mallei virulence?

The contribution of BMA1442 to virulence can be inferred from studies of homologous proteins in related pathogens. In Shigella flexneri, mutation of the ispA gene (homologous to BMA1442) resulted in an avirulent phenotype characterized by the bacteria's inability to spread throughout epithelial cell monolayers . This defect was linked to:

• Impaired cell division leading to filamentous bacteria trapped within host cells

• Defects in actin polymerization, which is essential for intracellular motility

• Compromised intercellular spread

By analogy, BMA1442 likely plays a similar critical role in B. mallei pathogenesis, particularly in the context of intracellular replication and spread. This is particularly significant given that B. mallei, the causative agent of glanders, is highly infectious via the respiratory route and can cause severe, often fatal diseases in humans and animals .

What is the relationship between BMA1442 and host immune responses?

While direct evidence for BMA1442's interaction with the host immune system is limited, B. mallei's pathogenicity involves complex interactions with host defenses. B. mallei expresses lipopolysaccharide (LPS) that activates human Toll-like receptor 4 complexes and stimulates human macrophage-like cells to produce pro-inflammatory cytokines including TNF-α, IL-6, and RANTES .

The potential connection between BMA1442 and immune responses may include:

• Role in maintaining bacterial viability during intracellular replication, which affects antigen presentation and recognition

• Possible indirect effects on cell surface components that interact with immune receptors

• Contribution to bacterial persistence within host cells, potentially evading immune clearance

Research examining immune responses to wild-type versus BMA1442-deficient B. mallei strains would help elucidate these relationships more clearly.

How might BMA1442 function during different stages of B. mallei infection?

Based on its predicted role in septation and the pathogenesis of related bacteria, BMA1442 likely functions at multiple stages of infection:

The importance of proper septation would be particularly critical during intracellular growth phases, where rapid bacterial replication must be coordinated with mechanisms for intercellular spread, similar to what has been observed with ispA in Shigella flexneri .

What structural biology approaches can reveal BMA1442 function?

Several advanced structural biology techniques could provide critical insights into BMA1442's function:

• X-ray crystallography: Though challenging for membrane proteins, this approach could reveal high-resolution structural details. Detergent screening would be necessary to identify conditions that maintain protein stability and allow crystallization.

• Cryo-electron microscopy (cryo-EM): Particularly suited for membrane proteins, this technique could visualize BMA1442 in near-native environments, potentially in complex with interaction partners.

• NMR spectroscopy: For specific domains or regions of the protein, solution NMR could provide dynamic information about protein flexibility and interactions.

• Molecular dynamics simulations: Using the amino acid sequence and predicted structure, computational approaches could model membrane insertion and potential conformational changes during septation.

• Cross-linking mass spectrometry: To identify interaction partners and protein complexes formed during septation.

The highly hydrophobic nature of BMA1442 presents technical challenges that would require specialized membrane protein structural biology approaches.

How can genetic manipulation techniques be used to study BMA1442 function?

Advanced genetic techniques can provide valuable insights into BMA1442 function:

• CRISPR-Cas9 genome editing: To create precise mutations or deletions in the BMA1442 gene, allowing assessment of phenotypic changes.

• Conditional expression systems: To control BMA1442 expression levels and timing, useful for studying essential genes.

• Domain swapping experiments: Replacing domains of BMA1442 with those from homologous proteins in other bacteria to identify functional conservation.

• Site-directed mutagenesis: To assess the importance of specific amino acid residues for protein function.

• Fluorescent protein fusions: To visualize protein localization and dynamics during bacterial cell division.

Notably, when working with B. mallei, appropriate biosafety considerations must be implemented as it is classified as a category B priority pathogen with potential for biological warfare applications .

What computational approaches can predict BMA1442 interactions and functional networks?

Computational methods provide powerful tools for generating hypotheses about BMA1442 function:

• Homology modeling: Using the structures of homologous proteins to predict BMA1442's tertiary structure.

• Protein-protein interaction predictions: Computational algorithms can identify potential binding partners based on sequence features and co-evolution patterns.

• Molecular docking: To predict interactions with small molecules or other proteins.

• Systems biology approaches: Integration of transcriptomic, proteomic, and metabolomic data to place BMA1442 within functional networks.

• Evolutionary analysis: Examination of BMA1442 conservation and variation across Burkholderia species and other bacterial genera to identify functionally important regions.

These computational predictions should guide experimental design for validation of predicted interactions and functions.

How does BMA1442 compare to septation proteins in other bacterial pathogens?

Comparative analysis reveals both similarities and differences between BMA1442 and homologous proteins:

The functional characterization of ispA in Shigella flexneri provides particularly relevant insights, as mutation of this gene resulted in bacteria unable to form proper septa, leading to filamentous morphology and impaired intracellular spread . These phenotypes strongly suggest that BMA1442 may function similarly in B. mallei's intracellular life cycle.

What is the evolutionary significance of BMA1442 conservation across Burkholderia species?

The conservation of BMA1442 across Burkholderia species has several important implications:

• Essential function: High conservation suggests fundamental importance to bacterial physiology.

• Pathogenic adaptation: Variations may reflect adaptations to different host environments or pathogenic strategies.

• Potential therapeutic target: Conservation across pathogenic species makes it a candidate for broad-spectrum therapeutic development.

• Vaccine development: While BMA1442 itself has not been explored as a vaccine candidate, research on B. mallei antigens indicates that conserved proteins between B. mallei and B. pseudomallei could potentially serve as targets for vaccines against both glanders and melioidosis .

Evolutionary analysis of sequence variations might identify regions under positive selection, potentially indicating host-pathogen interaction interfaces.

How do cytoskeletal interactions of BMA1442 compare with mechanisms in other bacterial pathogens?

Intracellular bacterial pathogens employ various strategies to interact with host cytoskeletal systems:

• Direct actin polymerization: Shigella flexneri utilizes IcsA protein for actin-comet tail formation, enabling intracellular motility . The ispA gene affects this process, suggesting BMA1442 may similarly impact cytoskeletal interactions in B. mallei.

• Rho GTPase manipulation: Shigella entry involves manipulation of host Cdc42, Rac, and Rho GTPases . Whether BMA1442 affects similar processes in B. mallei is unknown but represents an important area for investigation.

• Septation-cytoskeleton links: The septation process, which BMA1442 likely facilitates, must coordinate with potential cytoskeletal interactions during intracellular replication.

Understanding these comparative mechanisms could reveal whether BMA1442 directly or indirectly influences cytoskeletal dynamics during B. mallei infection, potentially through interaction with other bacterial effectors.