Recombinant Burkholderia mallei Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiB; BMASAVP1_A2757; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Burkholderia mallei (strain SAVP1)
Target Names
ubiB
Target Protein Sequence
MRIFRFVKIVFTVIRFGLDEVMLSRIENPRVKLLLRITTIGRRFADPPAVRLRRALESLG PIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIVEKSLGARIDVLFDEFE RVPVASASIAQVHFAKLKQGEHKGKAVAVKVLRPNMLPVIDSDLALMRDIATWAERLWAD GRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMFWDYSTPAVLVM ERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPKHF GRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPDTRVEELESAI RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL DLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTLPQLPRLVHQALISHHEAPRAIS DDLIRQILVEQRRTNRLLQALLVFGLAVGAGAVIARVLIVLAYGG
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which plays a role in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia mallei and why is UbiB protein significant?

Burkholderia mallei is a Gram-negative, nonmotile, facultatively intracellular bacterium that causes glanders, a contagious disease primarily affecting equines. Unlike most bacteria in the Burkholderiaceae family which are soil residents, B. mallei is an obligate mammalian pathogen . Horses serve as the natural reservoir for infection, although mules and donkeys are also susceptible .

The UbiB protein is significant because it functions as a probable ubiquinone biosynthesis protein, which is essential for bacterial respiratory electron transport chains. In related Burkholderia species, UbiB has been identified as an essential gene, as conditional mutants lacking UbiB function fail to grow under restrictive conditions . This essentiality makes it a potential target for antimicrobial development against B. mallei, which is classified as a Tier 1 bioterrorism agent due to its high virulence .

What is the molecular characterization of B. mallei UbiB protein?

The B. mallei UbiB protein is characterized as follows:

CharacteristicDescription
Full NameProbable ubiquinone biosynthesis protein UbiB / Probable protein kinase UbiB
Gene NameubiB
Locus TagBMA10247_2401 (in strain NCTC 10247)
Protein LengthFull protein (typically 525 amino acids)
FunctionInvolved in ubiquinone (coenzyme Q) biosynthesis
EssentialityPutatively essential based on homology to essential genes in related species

The protein contains specific amino acid sequences that are conserved across Burkholderia species, with domains consistent with its function in ubiquinone biosynthesis . The expression region typically spans positions 1-525 of the protein sequence .

How can recombinant B. mallei UbiB be optimally expressed and purified for research applications?

For optimal expression and purification of recombinant B. mallei UbiB, several expression systems can be utilized, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay have issues with protein folding, lacks post-translational modifications
YeastEukaryotic post-translational modifications, proper foldingLower yield than bacterial systems
BaculovirusHigh expression levels, complex protein productionMore time-consuming, technically demanding
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yield

The methodology involves:

  • Gene synthesis or PCR amplification of the ubiB gene from B. mallei genomic DNA

  • Cloning into an appropriate expression vector with a selected tag (commonly His-tag)

  • Transformation into the chosen expression system

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification via affinity chromatography

  • Further purification using size exclusion or ion exchange chromatography

The choice of tag is critical for downstream applications. While the tag type may be determined during the manufacturing process, common tags include His-tags for simplified purification or Avi-tags for biotinylation . For structural studies, tag removal via protease cleavage sites can be incorporated into the construct design.

What methodological approaches are recommended for studying UbiB essentiality in B. mallei?

To study UbiB essentiality in B. mallei, conditional mutant systems offer the most rigorous approach. Based on strategies used with related Burkholderia species, the following methodological pipeline is recommended:

  • Generation of conditional mutants using a rhamnose-inducible promoter system:

    • Clone approximately 300 bp fragments spanning the 5' region of the ubiB gene into a plasmid like pSC200, which contains a rhamnose-inducible promoter

    • Transfer the recombinant plasmid into B. mallei via conjugation

    • Select for recombinants where homologous recombination has replaced the native promoter with the rhamnose-inducible promoter

  • Validation of conditional essentiality:

    • Grow the conditional mutant in both permissive (with rhamnose) and non-permissive (with glucose) conditions

    • Monitor growth curves in liquid media and on solid media

    • Quantify bacterial viability using appropriate staining techniques

    • Measure ubiB expression levels under different conditions using RT-qPCR

  • Complementation studies:

    • Introduce a wild-type copy of ubiB in trans on a compatible plasmid

    • Confirm restoration of growth under non-permissive conditions

    • This confirms that the growth defect is specifically due to ubiB inactivation rather than polar effects

This approach has been successfully employed with the ubiB homolog in B. cenocepacia, where the conditional mutant grew in the presence of rhamnose but was unable to grow in the presence of glucose, definitively demonstrating its essentiality .

How can recombinant B. mallei UbiB be utilized for development of improved diagnostic tests?

Current diagnosis of B. mallei infections faces challenges with sensitivity and specificity, particularly due to cross-reactivity with related species like B. pseudomallei . Recombinant UbiB protein can be utilized for improved diagnostics through:

  • ELISA-based detection systems:

    • Coat microplates with purified recombinant UbiB

    • Test sera for specific antibodies against UbiB

    • Implement various blocking strategies to reduce background

    • Develop quantitative standards for determining antibody titers

  • Multiplex protein arrays:

    • Include UbiB alongside other B. mallei-specific proteins

    • Analyze reactivity patterns to distinguish between B. mallei and related species

    • Use machine learning algorithms to identify species-specific antibody signatures

  • Development of monoclonal antibodies:

    • Immunize mice with recombinant UbiB

    • Generate hybridoma cells producing anti-UbiB antibodies

    • Screen for antibodies with high specificity for B. mallei UbiB

    • Use these antibodies in direct detection assays for B. mallei

The diagnostic potential requires careful validation by testing:

  • Cross-reactivity with proteins from B. pseudomallei (which shares ~99.5% DNA sequence identity with B. mallei)

  • Specificity using sera from animals infected with other bacterial pathogens

  • Sensitivity using serially diluted samples from confirmed cases

What are the recommended protocols for evaluating UbiB enzymatic activity?

To evaluate the enzymatic activity of recombinant B. mallei UbiB, which is classified as a probable protein kinase involved in ubiquinone biosynthesis , the following experimental protocols are recommended:

  • ATP binding and hydrolysis assays:

    • Measure ATPase activity using colorimetric phosphate detection

    • Determine kinetic parameters (Km, Vmax) using varying substrate concentrations

    • Compare wild-type activity with site-directed mutants of key catalytic residues

  • Protein kinase activity assays:

    • Identify potential protein substrates in the ubiquinone biosynthesis pathway

    • Use radiolabeled ATP (γ-32P-ATP) to detect phosphorylation events

    • Confirm specificity through competition with unlabeled ATP

  • Complementation studies in model systems:

    • Express B. mallei UbiB in E. coli ubiB knockout strains

    • Measure restoration of ubiquinone production using HPLC analysis

    • Quantify growth rates under conditions requiring respiratory electron transport

  • Structural analysis approaches:

    • Perform X-ray crystallography or cryo-EM to determine protein structure

    • Conduct molecular docking simulations with potential substrates

    • Use hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

These protocols should be conducted with appropriate controls, including enzyme-free and substrate-free reactions, heat-inactivated enzyme, and known inhibitors of related kinases.

How can researchers address cross-reactivity challenges when working with B. mallei UbiB?

Cross-reactivity presents a significant challenge when working with B. mallei proteins due to the close relationship with B. pseudomallei and other Burkholderia species . To address this challenge specifically for UbiB:

  • Sequence analysis for unique epitopes:

    • Perform comprehensive sequence alignments of UbiB across all Burkholderia species

    • Identify regions unique to B. mallei UbiB or with significant sequence divergence

    • Design truncated constructs containing these unique regions for immunological studies

  • Epitope mapping techniques:

    • Generate overlapping peptide libraries covering the entire UbiB sequence

    • Test reactivity with sera from animals infected with different Burkholderia species

    • Identify peptides that uniquely react with B. mallei-specific antibodies

  • Absorption studies to eliminate cross-reactivity:

    • Pre-absorb test sera with recombinant proteins from related species

    • Gradually increase stringency of washing steps to retain only highly specific antibodies

    • Quantify improvement in specificity using statistical methods

  • Validation using diverse clinical samples:

    • Test with sera from confirmed cases of:
      a) Glanders (B. mallei)
      b) Melioidosis (B. pseudomallei)
      c) Unrelated bacterial infections
      d) Healthy controls from endemic and non-endemic regions

    • Calculate sensitivity, specificity, and predictive values

These approaches are critical since B. mallei and B. pseudomallei share approximately 99.5% DNA-DNA sequence identity with their respective orthologues , making specific detection particularly challenging.

What statistical approaches are recommended for analyzing UbiB structure-function relationships?

  • Multiple sequence alignment analysis:

    • Calculate conservation scores for each amino acid position

    • Identify co-evolving residues using mutual information analysis

    • Apply phylogenetic correction to avoid bias from closely related sequences

  • Structure-based statistical analyses:

    • Use ANOVA to compare activity levels of different structural variants

    • Employ multiple regression to identify correlations between structural features and functional parameters

    • Implement principal component analysis to identify key structural determinants of function

  • Machine learning approaches:

    • Train neural networks to predict functional outcomes from structural variations

    • Use random forest algorithms to rank the importance of different structural features

    • Apply cross-validation techniques to ensure model robustness

  • Molecular dynamics simulation analysis:

    • Calculate root-mean-square deviation (RMSD) and fluctuation (RMSF) values

    • Perform cluster analysis of conformational states

    • Use statistical thermodynamics to estimate free energy differences between states

When comparing experimental results across different structural variants of UbiB, recommended statistical parameters include:

Statistical ParameterApplicationInterpretation
p-valueHypothesis testingTypically significant if <0.05, but multiple testing correction may be needed
Confidence intervalsEstimate precision95% CI provides range of plausible values
Effect size (Cohen's d)Magnitude of differenceSmall (0.2), Medium (0.5), Large (0.8)
Correlation coefficientsStructure-function relationshipsValues range from -1 to 1; strength depends on specific application

How should contradictory results in UbiB functional studies be reconciled?

When faced with contradictory results in functional studies of B. mallei UbiB, a systematic approach to reconciliation is necessary:

  • Methodological analysis:

    • Compare detailed experimental protocols including buffer compositions, reaction conditions, and protein preparations

    • Evaluate differences in expression systems and protein tags that might affect activity

    • Assess the sensitivity and specificity of different detection methods

  • Context-dependent function assessment:

    • Test UbiB function under varying physiological conditions (pH, ion concentration, redox state)

    • Examine potential species-specific differences in UbiB activity between B. mallei and related organisms

    • Investigate tissue or cell-type specific factors that might modulate function

  • Integrative data analysis:

    • Perform meta-analysis of multiple independent studies

    • Weight results based on methodological rigor and sample size

    • Use Bayesian approaches to update probability estimates as new evidence emerges

  • Collaborative verification:

    • Establish multi-laboratory testing of identical protein preparations

    • Develop standardized protocols for UbiB functional assays

    • Share raw data through repositories for independent reanalysis

When specific contradictions arise, develop a hypothesis-testing framework that can directly address the source of discrepancy, rather than simply replicate previous work. For instance, if one study shows UbiB is essential while another suggests dispensability, design experiments that test essentiality under various environmental conditions that might explain both observations.

What are promising approaches for developing inhibitors targeting B. mallei UbiB?

Given the potential essentiality of UbiB in B. mallei and its role in ubiquinone biosynthesis, several approaches for inhibitor development are promising:

  • Structure-based drug design:

    • Utilize crystal structures or homology models of UbiB

    • Perform virtual screening of compound libraries targeting the ATP-binding pocket

    • Design competitive inhibitors that mimic transition states of the enzymatic reaction

  • High-throughput screening strategies:

    • Develop fluorescence-based activity assays suitable for 384-well format

    • Screen diverse chemical libraries including natural products

    • Implement counter-screens to eliminate compounds with activity against human homologs

  • Fragment-based drug discovery:

    • Screen fragment libraries for weak but efficient binders

    • Use NMR, X-ray crystallography, or surface plasmon resonance to validate binding

    • Link or grow fragments to develop high-affinity inhibitors

  • Allosteric inhibitor development:

    • Identify allosteric sites through molecular dynamics simulations

    • Design compounds that stabilize inactive conformations

    • Target protein-protein interaction interfaces if UbiB functions in a complex

The druggability assessment of UbiB is supported by its predicted essentiality in B. mallei, based on studies of homologs in related Burkholderia species that demonstrated inability to grow under restrictive conditions when UbiB function was compromised .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.