Recombinant Burkholderia mallei Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Characteristics and Function

Protein Name: Prolipoprotein Diacylglyceryl Transferase
Gene Name: lgt
EC Number: 2.4.99.-
Species: Burkholderia mallei (strain NCTC 10229)

Key Functional Attributes:

  • Catalytic Role: Transfers sn-1,2-diacylglyceryl groups to prolipoproteins, forming lipid-modified precursors essential for membrane anchoring .

  • Essentiality: Critical for bacterial viability and virulence, making it a potential antibiotic target .

  • Conservation: Structurally and functionally conserved across Gram-negative and Gram-positive bacteria, with a signature motif (e.g., residues R143, E151) critical for substrate recognition .

Recombinant Production

Recombinant B. mallei Lgt is produced in E. coli systems for research applications :

Antibiotic Development

  • Target Validation: Lgt’s essential role in lipoprotein maturation makes it a candidate for novel antibiotics .

  • Inhibitor Screening: Structural studies (e.g., palmitic acid binding in E. coli Lgt) guide inhibitor design .

Diagnostic Tools

  • Serodiagnosis: Recombinant Lgt is evaluated as an antigen for detecting B. mallei infections in glanders .

  • Cross-Reactivity: Shares epitopes with B. pseudomallei, aiding pan-Burkholderia diagnostic assays .

Vaccine Research

  • Antigenic Potential: Lipoproteins modified by Lgt are immunogenic and explored as vaccine components .

Functional Mutagenesis

  • Critical Residues: Alanine substitution studies identified Y26, N146, and G154 as indispensable for activity .

  • Catalytic Mechanism: Proposed SN2-like reaction involving a thioester intermediate .

Biotechnological Relevance

  • Stability: Recombinant Lgt retains activity after freeze-thaw cycles if stored in glycerol-containing buffers .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lgt; BMASAVP1_A2332; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Burkholderia mallei (strain SAVP1)
Target Names
lgt
Target Protein Sequence
MIIHPNFDPVAIHLGPLAVRWYGLMYLVGFILAIVVGRLRLKLPHVAAQGWSAKDIDDMM FYGVLGVVLGGRLGYVLFYKAGYYFSHPLDIFRVWEGGMSFHGGFLGVTLAMALFAWQRK RHWLEVTDFVAPMVPTGLAAGRLGNFINGELWGRVTSPDAPWAMLFPGASRDDAAWLAAH QDIAAKWNLNEVFLSHQMLPRHPSQLYEIALEGIALFFVLWFFSRKPRPMGAISALFLIG YGAARFTVEFAREPDDFLGLLTFGLSMGQWLSLPMIVAGVLMMIWAYRRGGVAKQA
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) in Burkholderia mallei and what is its function?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme involved in the first step of bacterial lipoprotein maturation in B. mallei. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoproteins . This posttranslational modification is critical for proper lipoprotein function in bacteria, including B. mallei. The resulting lipoproteins perform diverse functions in bacterial physiology, including cell division, cellular infrastructure maintenance, protein localization, antibiotic resistance, nutrient adsorption, and signal transduction .

B. mallei Lgt belongs to the prolipoprotein diacylglyceryl transferase family (PF01790) and contains the characteristic signature sequence identified as PS01311 . The enzyme is membrane-bound and plays a crucial role in the pathogen's ability to modify proteins for proper membrane localization and function.

How does B. mallei Lgt differ structurally and functionally from Lgt in other Burkholderia species?

B. mallei Lgt shares significant homology with Lgt proteins from other Burkholderia species, particularly B. pseudomallei, which is evolutionarily related. Genomic studies have revealed that B. mallei represents a distinct clade of B. pseudomallei that has undergone significant genome reduction and genetic reassortment during adaptation to an obligate intracellular lifestyle . This evolutionary relationship suggests that while the core functional domains of Lgt are likely conserved between these species, there may be subtle differences in regulation or substrate specificity.

The conserved prolipoprotein diacylglyceryl transferase signature (PS01311) in B. mallei Lgt spans residues that are distributed between the periplasmic space and inner membrane, specifically residues 142 to 154 based on topology studies . This membrane topology is critical for the enzyme's function, as it must access both the lipid substrate in the membrane and the protein substrate with its conserved cysteine residue.

Unlike environmental Burkholderia species like B. thailandensis, B. mallei has a reduced genome that reflects its adaptation to a host-restricted lifestyle . This genomic reduction may influence the regulation and substrate range of Lgt, potentially focusing its activity on lipoproteins essential for host interaction and survival.

What experimental approaches are most effective for studying the membrane topology of B. mallei Lgt?

Determining the membrane topology of B. mallei Lgt requires a combination of classical and modern molecular biological techniques. Effective approaches include:

  • Fusion protein analysis: Creating fusion proteins between segments of Lgt and reporter enzymes like alkaline phosphatase (PhoA) or β-galactosidase (LacZ) to determine which portions are cytoplasmic versus periplasmic .

  • Cysteine accessibility methods: Introducing cysteine residues at various positions in the protein and assessing their accessibility to membrane-impermeable thiol-reactive reagents.

  • Proteolytic digestion: Limited proteolysis of membrane preparations containing Lgt, followed by mass spectrometry to identify protected versus exposed regions.

  • Computational prediction: Using bioinformatic tools to predict transmembrane domains, followed by experimental validation.

Research by Pailler et al. demonstrated the value of combining these approaches to resolve the membrane topology of Lgt proteins . Their work revealed limitations of computational predictions alone and highlighted the importance of experimental verification. For B. mallei Lgt specifically, researchers should be mindful that its distinct evolutionary history may have resulted in subtle structural differences compared to other bacterial Lgt proteins.

How can recombinant B. mallei Lgt be effectively expressed and purified for functional studies?

Expression and purification of functional recombinant B. mallei Lgt presents several challenges due to its hydrophobic nature and membrane integration. Based on current research approaches, an effective methodology would include:

Expression system selection:

  • E. coli expression systems have been successfully used to produce recombinant B. mallei proteins, as evidenced by the commercially available His-tagged full-length B. mallei Lgt .

  • BL21(DE3) or C41/C43(DE3) E. coli strains are recommended for membrane protein expression.

Vector design considerations:

  • Include an affinity tag (His-tag is commonly used) for purification .

  • Consider a cleavable tag if native protein is needed for functional studies.

  • Codon optimization may improve expression levels.

Expression conditions:

  • Lower induction temperatures (16-25°C) often improve membrane protein folding.

  • Inducer concentration optimization is critical (typically 0.1-0.5 mM IPTG for lac-based systems).

  • Extended expression times (overnight) at lower temperatures may increase yield of properly folded protein.

Membrane extraction and purification:

  • Cell lysis using mechanical disruption (sonication or French press)

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization using appropriate detergents (n-dodecyl-β-D-maltoside, CHAPS, or digitonin)

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography for final purification

Functional verification:

  • In vitro enzymatic assays using synthetic peptide substrates containing the lipobox motif

  • Mass spectrometry to confirm diacylglyceryl transfer activity

Researchers should note that B. mallei is a Biosafety Level 3 pathogen, requiring appropriate containment facilities for working with the native organism . Recombinant protein work can be conducted at lower biosafety levels depending on institutional guidelines and risk assessment.

What are the biochemical characteristics of the B. mallei Lgt enzymatic reaction?

The B. mallei Lgt enzymatic reaction involves the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in prolipoproteins. This reaction has several important biochemical characteristics:

Reaction mechanism:

  • Direct transfer of the diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine

  • The reaction does not involve separate addition of a glyceryl group followed by acylation, as was once thought

Substrate specificity:

  • The enzyme recognizes a specific sequence motif called the lipobox ([LVI][ASTVI][GAS][C]) in the target prolipoprotein

  • The conserved cysteine (C) within this motif is the acceptor of the diacylglyceryl group

  • Phosphatidylglycerol serves as the preferred lipid donor

Reaction conditions:

  • The reaction occurs at the cytoplasmic membrane interface

  • Requires proper membrane environment for activity

  • pH optimum likely near physiological (pH 6.5-7.5)

Kinetic parameters:

How has the evolution of the lgt gene in B. mallei been influenced by genome reduction compared to B. pseudomallei?

B. mallei has undergone significant genome reduction during its evolution from a B. pseudomallei-like ancestor, adapting to an obligate intracellular lifestyle . This evolutionary process has several implications for the lgt gene:

Genomic context and conservation:

  • The lgt gene has been retained in B. mallei despite extensive genome reduction, suggesting its essential nature

  • While B. pseudomallei has a large genome (~7.2 Mb) with extensive horizontal gene transfer, B. mallei has a reduced genome with evidence of substantial deletion events and genomic rearrangements

  • The core cellular machinery, including lipoprotein processing enzymes like Lgt, has been maintained in B. mallei, while environmental adaptation genes have been lost

Selection pressure:

  • The lgt gene in B. mallei likely experiences purifying selection to maintain its essential function in lipoprotein maturation

  • The host-adapted lifestyle of B. mallei may have led to specialized adaptations in lipoprotein processing

  • Horizontal gene transfer, which contributes significantly to genetic diversity in B. pseudomallei (with recombination to mutation ratios of 18-30:1, the highest reported for any bacterial species), is substantially reduced in B. mallei

Functional implications:

  • The genome reduction in B. mallei suggests that the lipoproteins processed by Lgt are likely focused on host interaction and survival rather than environmental adaptation

  • The substrate range of B. mallei Lgt may be narrower than that of B. pseudomallei, reflecting the reduced proteome

  • The retention of lgt in the streamlined B. mallei genome highlights its importance for pathogen survival within host cells

This evolutionary context provides important insights for researchers studying B. mallei Lgt, suggesting that while the core enzymatic function is conserved, its regulation and the spectrum of lipoproteins it processes may differ from environmental Burkholderia species.

What experimental systems can be used to evaluate the enzymatic activity of recombinant B. mallei Lgt?

Several experimental systems can be employed to assess the enzymatic activity of recombinant B. mallei Lgt:

In vitro biochemical assays:

  • Radiolabeled lipid incorporation assay:

    • Using [³H] or [¹⁴C]-labeled phospholipids as donors

    • Synthetic peptide substrates containing the lipobox motif as acceptors

    • Monitoring incorporation of radiolabel into the peptide substrate

  • Mass spectrometry-based assays:

    • Detection of mass shift upon diacylglyceryl addition to peptide substrates

    • Structural characterization of modified lipopeptides

    • Quantitative analysis of substrate conversion rates

  • Fluorescence-based assays:

    • Fluorescently labeled peptide substrates

    • FRET-based detection of conformational changes upon lipidation

    • High-throughput adaptable for inhibitor screening

Reconstituted membrane systems:

  • Liposome reconstitution with purified Lgt

  • Nanodiscs incorporating the enzyme in a native-like lipid environment

  • Supported lipid bilayers for surface-sensitive detection techniques

Cellular complementation assays:

  • Heterologous expression in E. coli lgt mutants

  • Assessment of functional complementation through restoration of lipoprotein processing

  • Analysis of processed lipoproteins by gel mobility shift or mass spectrometry

Table 1: Comparison of Methods for Assessing B. mallei Lgt Activity

MethodAdvantagesLimitationsDetection LimitThroughput
Radiolabeled lipid assayDirect measurement of lipid transferSafety concerns, waste disposalHighly sensitive (pmol)Low to medium
Mass spectrometryDetailed structural informationEquipment cost, expertise requiredMedium (fmol-pmol)Low to medium
Fluorescence-basedReal-time monitoring possiblePotential interference from labelsMedium (nmol)High
Cellular complementationNative-like conditionsIndirect measurementN/ALow
Nanodisc reconstitutionNative membrane environmentComplex preparationVaries by detection methodLow

When designing these assays, researchers should consider using synthetic peptides derived from known B. mallei lipoproteins as substrates to ensure physiological relevance. The distinctive membrane topology of Lgt, with portions spanning between the periplasmic space and inner membrane , should inform the design of reconstituted systems to ensure proper orientation and access to substrates.

How can structural studies of B. mallei Lgt inform the development of potential inhibitors?

Structural studies of B. mallei Lgt can provide critical insights for inhibitor development through several approaches:

X-ray crystallography and cryo-EM approaches:

  • Determination of the three-dimensional structure of B. mallei Lgt would reveal the active site architecture

  • Co-crystallization with substrate analogs can identify key binding interactions

  • The membrane topology data indicating that the prolipoprotein diacylglyceryl transferase signature spans residues 142-154 between the periplasmic space and inner membrane provides initial guidance for structural studies

Structure-based inhibitor design:

  • Identification of catalytic residues within the active site

  • Design of compounds that mimic the transition state of the lipid transfer reaction

  • Development of peptidomimetics that compete with the lipobox motif for binding

Molecular dynamics simulations:

  • Modeling of protein-membrane interactions critical for activity

  • Simulation of substrate binding and product release

  • Virtual screening of compound libraries against the active site

Comparative analysis with other bacterial Lgt structures:

  • Identification of conserved features across bacterial Lgt enzymes

  • Highlighting B. mallei-specific features that could be targeted for selective inhibition

  • The evolutionary relationship between B. mallei and B. pseudomallei suggests structural similarities in their Lgt enzymes , allowing insights from either organism to inform inhibitor design

Table 2: Potential Target Sites in B. mallei Lgt Based on Functional Domains

Domain/RegionResiduesFunctionInhibitor Strategy
Signature motif142-154Substrate recognition/catalysisCompetitive inhibitors
Transmembrane regionsVariousMembrane anchoringMembrane-disrupting agents
Lipid binding pocketPredictedPhospholipid bindingLipid analogs
Prolipoprotein binding sitePredictedRecognition of lipobox motifPeptidomimetics

The development of inhibitors targeting B. mallei Lgt could have significant therapeutic implications for treating Glanders, a disease with limited treatment options and potential as a bioterrorism agent . Since the Lgt enzyme appears essential for bacterial viability in Gram-negative bacteria , it represents a promising target for novel antimicrobial development.

How can recombinant B. mallei Lgt be used to improve diagnostic tools for Glanders?

Recombinant B. mallei Lgt offers several avenues for improving Glanders diagnostic tools, addressing the current challenges in diagnosis outlined in the literature :

Serological diagnostics:

  • Development of Lgt-based ELISA or other immunoassays for antibody detection

  • Potential to distinguish B. mallei infection from exposure to related environmental Burkholderia species

  • Mitigation of the cross-reactivity issues observed with current serological tests between B. mallei and B. pseudomallei

Antigen detection systems:

  • Direct detection of Lgt or Lgt-processed lipoproteins in clinical samples

  • Development of aptamer or antibody-based capture systems specific for B. mallei lipoproteins

  • Integration into point-of-care diagnostic platforms

Molecular diagnostics:

  • PCR primers targeting B. mallei lgt gene sequences

  • LAMP (Loop-mediated isothermal amplification) assays for field-deployable diagnosis

  • Next-generation sequencing approaches to detect B. mallei-specific lgt variants

The unique evolutionary history of B. mallei, which shows significant genome reduction compared to B. pseudomallei , suggests that there may be subtle but important differences in the lgt gene that could be exploited for specific diagnostic tests. Targeting these differences could help address the significant challenge of distinguishing B. mallei from closely related Burkholderia species, which is a known difficulty in current diagnostic approaches .

Improved diagnostics are particularly important given that B. mallei infection (Glanders) is a rare but serious disease potential, especially as a bioterrorism agent . The laboratory case reported in 2000 in the United States demonstrated the difficulties in diagnosing clinical B. mallei infection and the problems with misidentification using routine laboratory methods .

What is the potential of B. mallei Lgt as a therapeutic target for treating Glanders?

B. mallei Lgt holds significant promise as a therapeutic target for treating Glanders for several reasons:

Essential nature of the enzyme:

  • Lgt is considered essential for viability in Gram-negative bacteria

  • Inhibition would potentially be bactericidal rather than bacteriostatic

  • The lipidation pathway in which Lgt participates has been validated as an antibiotic target, with the signal peptidase being a target for the antibiotic globomycin

Unique aspects favoring drug development:

  • No human homolog exists, reducing the risk of off-target effects

  • The enzyme is accessible in the bacterial membrane

  • The catalytic mechanism involves unique chemistry not found in human cells

Therapeutic approaches:

  • Small molecule inhibitors:

    • Competitive inhibitors mimicking the lipobox motif

    • Non-competitive inhibitors targeting allosteric sites

    • Covalent inhibitors targeting catalytic residues

  • Peptide-based inhibitors:

    • Peptidomimetics based on the lipobox sequence

    • Stapled peptides with enhanced stability and membrane permeability

    • Lipopeptides that compete for the active site

  • Combination therapies:

    • Co-administration with current antibiotics to enhance efficacy

    • Multi-target approaches inhibiting multiple steps in lipoprotein processing

The development of Lgt inhibitors would be particularly valuable because B. mallei shows resistance to many conventional antibiotics. Additionally, the persistence of B. mallei in host tissues and potential for relapse makes new therapeutic approaches essential. The evolutionary relationship between B. mallei and B. pseudomallei suggests that therapeutics targeting Lgt might be effective against both pathogens , addressing two significant bioterrorism threats with a single approach.

Given the rise of antimicrobial resistance globally, novel targets like Lgt represent important opportunities for new therapeutic development.

What are the major challenges in studying B. mallei Lgt and how can they be addressed?

Researchers studying B. mallei Lgt face several significant challenges that require innovative approaches:

Biosafety considerations:

  • B. mallei is classified as a Biosafety Level 3 (BSL-3) pathogen with potential bioterrorism applications

  • Work with native B. mallei requires specialized containment facilities and training

  • Solution: Use of recombinant systems, surrogate organisms, or closely related less-pathogenic Burkholderia species for preliminary studies

Membrane protein purification difficulties:

  • Lgt is an integral membrane protein with multiple transmembrane domains

  • Obtaining properly folded, functional protein is technically challenging

  • Solution: Advanced membrane protein purification techniques, fusion partners to enhance solubility, and nanodiscs or other membrane mimetics for stabilization

Functional assay development:

  • Demonstrating enzymatic activity requires both lipid and protein substrates

  • Monitoring lipid transfer reactions can be technically demanding

  • Solution: Development of high-throughput fluorescence-based assays, mass spectrometry approaches, or cellular reporter systems

Cross-reactivity with related species:

  • High genetic similarity between B. mallei and B. pseudomallei complicates specific targeting

  • Serological cross-reactivity has been demonstrated between these species

  • Solution: Detailed comparative analysis to identify unique aspects of B. mallei Lgt, epitope mapping to find species-specific regions

Limited availability of clinical isolates:

  • Glanders is rare in Western countries, limiting strain diversity for research

  • Historic samples may not represent current circulating strains

  • Solution: International collaboration with endemic regions, genome database analysis, synthetic biology approaches to study variant forms

Addressing these challenges will require multidisciplinary approaches combining structural biology, biochemistry, microbiology, and computational methods. The development of safer surrogate systems that accurately reflect B. mallei Lgt function would substantially accelerate research in this field.

What future research directions would advance our understanding of B. mallei Lgt?

Several promising research directions could significantly advance our understanding of B. mallei Lgt and its potential applications:

Comprehensive structural characterization:

  • Determination of high-resolution crystal or cryo-EM structures of B. mallei Lgt

  • Mapping of substrate binding sites and catalytic residues

  • Comparative structural analysis with Lgt from other bacterial species

Systems biology approaches:

  • Identification of the complete lipoprotein repertoire (lipoproteome) in B. mallei

  • Analysis of how lipoprotein processing changes during infection

  • Network analysis of lipoprotein interactions and functions

Host-pathogen interaction studies:

  • Investigation of how Lgt-processed lipoproteins interact with host immune systems

  • Role of specific lipoproteins in B. mallei pathogenesis

  • Comparative analysis with the more extensively studied B. pseudomallei

Evolutionary analysis:

  • Detailed investigation of how genome reduction in B. mallei has affected the lgt gene and its regulation

  • Comparative genomics of lgt across Burkholderia species

  • Exploration of horizontal gene transfer events that might have shaped lgt evolution

Drug discovery campaigns:

  • High-throughput screening for Lgt inhibitors

  • Fragment-based drug discovery approaches

  • Structure-guided design of selective inhibitors

Development of genetic tools:

  • Conditional knockdown systems to study Lgt essentiality in B. mallei

  • Reporter systems to monitor Lgt activity in vivo

  • CRISPR-Cas9 approaches for precise genetic manipulation

The high recombination rates observed in Burkholderia species (with recombination to mutation ratios of 18-30:1) suggest that evolutionary approaches might be particularly informative for understanding how Lgt function may vary across strains and species. Additionally, given the genomic islands identified in Burkholderia genomes and evidence of lateral gene transfer , investigating whether lgt has been subject to horizontal transfer events could provide insights into its evolutionary history and functional adaptation.

These future directions would not only advance basic science understanding of bacterial lipoprotein processing but could also lead to practical applications in diagnostics and therapeutics for this important pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.