Recombinant Burkholderia mallei Translocator protein BipB (bipB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia mallei Translocator Protein BipB (bipB)

Burkholderia mallei is a Gram-negative bacterium that causes glanders, a disease primarily affecting horses, donkeys, and mules, but also transmissible to humans . Burkholderia pseudomallei is closely related to B. mallei and causes melioidosis . Both bacteria utilize a Type III Secretion System (T3SS) for virulence, injecting effector proteins into host cells to manipulate cellular processes .

BipB is a key component of the T3SS in Burkholderia species, specifically associated with the Bsa T3SS . It functions as a translocator protein, facilitating the transfer of bacterial proteins into host cells . BipB shares homology with SipB in Salmonella and IpaB in Shigella, which are also translocator proteins involved in similar mechanisms of pathogenesis .

Functional Role in Pathogenesis

  1. Translocation: BipB is essential for the translocation of bacterial proteins into host cells. It forms a pore in the host cell membrane, allowing the direct passage of effector proteins from the bacterial cytoplasm into the host cell .

  2. Cell Invasion and Spread: Studies have shown that B. pseudomallei mutants lacking BipB exhibit reduced invasion and cell-to-cell spread in host cells . This highlights the importance of BipB in the early stages of infection .

  3. Multinucleated Giant Cell (MNGC) Formation: BipB has been implicated in the formation of MNGCs, which are characteristic of Burkholderia infections . A bipB mutant was unable to induce MNGC formation in macrophage-like cells, indicating that BipB is involved in cell fusion .

Data Tables

FeatureBipBBipC
HomologuesSipB (Salmonella), IpaB (Shigella)SipC (Salmonella), IpaC (Shigella)
FunctionTranslocation of bacterial proteins into host cellsActin polymerization and stabilization; formation of translocon pore
Role in PathogenesisCell invasion, cell-to-cell spread, MNGC formationInternalization of B. pseudomallei
ConservationHighly conserved among B. pseudomallei and B. mallei isolates
Vaccine PotentialLow protection as a standalone vaccine
Diagnostic PotentialAntibodies detected in melioidosis patients

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment accordingly.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
bipB; BMA10229_2071; Translocator protein BipB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Burkholderia mallei (strain NCTC 10229)
Target Names
bipB
Target Protein Sequence
MSSGVQGGPAANANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKRYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV
Uniprot No.

Target Background

Function

BipB plays a crucial role in Burkholderia mallei-induced formation of multinucleated giant cells (MNGCs) through host cell fusion. It also contributes to intracellular bacterial spread and apoptosis induction in macrophages. BipB likely acts synergistically with other effector proteins to mediate host cell membrane fusion.

Database Links
Protein Families
Invasin protein B family
Subcellular Location
Secreted. Host membrane.

Q&A

What is the BipB protein and what is its role in Burkholderia pathogenesis?

BipB is a type III secretion system (T3SS) translocator protein found in Burkholderia species, including B. mallei and B. pseudomallei. This protein plays a critical role in bacterial pathogenesis by facilitating the delivery of bacterial effector proteins into host cells. In B. pseudomallei, BipB has been shown to be essential for efficient induction of apoptosis in infected host cells, although a low level of apoptosis may still occur via BipB-independent mechanisms . It also contributes to multinucleated giant cell (MNGC) formation and cell-to-cell spreading, which are key virulence mechanisms . While much of the research has focused on B. pseudomallei BipB, the high genetic similarity between B. mallei and B. pseudomallei (approximately 99.5% DNA-DNA sequence identity) suggests similar functions in B. mallei .

How does BipB in B. mallei differ from its ortholog in B. pseudomallei?

Despite the close genetic relationship between B. mallei and B. pseudomallei, with nearly 99.5% DNA-DNA sequence identity in shared genes, there may be subtle structural or functional differences in their BipB proteins . B. mallei is essentially a deletion clone of B. pseudomallei that has lost over 1,000 genes during its evolution, but has retained the genes encoding for the type III secretion system, including BipB . The specific differences in BipB function between these species require further comparative analysis, particularly regarding host cell interactions and contribution to virulence in their respective disease pathogenesis (glanders for B. mallei and melioidosis for B. pseudomallei).

Why is recombinant BipB important for Burkholderia research?

Recombinant BipB proteins provide valuable tools for multiple research applications:

  • Diagnostic development: Recombinant proteins offer potential for developing specific serological tests for glanders, addressing the challenge of cross-reactivity between B. mallei and B. pseudomallei in current diagnostics .

  • Vaccine research: Purified recombinant BipB can be evaluated as a vaccine candidate against B. mallei infections .

  • Pathogenesis studies: Recombinant proteins allow for detailed investigation of BipB's molecular interactions with host cells without the biosafety concerns of working with live pathogens.

  • Structure-function analysis: Expression of modified recombinant BipB variants enables mapping of functional domains responsible for specific virulence properties.

What are the key considerations when designing experiments to study BipB function?

When designing experiments to investigate BipB function, researchers should follow these methodological principles:

  • Define clear variables: Establish independent variables (e.g., wild-type vs. mutant BipB expression) and dependent variables (e.g., apoptosis rates, MNGC formation frequency) .

  • Formulate specific hypotheses: For example, "Genetic inactivation of bipB will reduce the ability of B. mallei to induce apoptosis in macrophages by at least 50% compared to wild-type."

  • Include appropriate controls: Wild-type strains, bipB knockout mutants, and complemented strains (knockout with restored bipB function) .

  • Minimize confounding variables: Control for bacterial growth rates, infection doses, and host cell conditions .

  • Select appropriate model systems: Consider both in vitro (cell culture) and in vivo (animal) models relevant to the research question .

  • Plan for quantitative measurements: Design methods to quantify outcomes such as apoptosis rates, bacterial invasion efficiency, or virulence in animal models .

  • Statistical analysis: Determine appropriate statistical methods before beginning experiments .

How can I design a study to evaluate BipB as a diagnostic antigen for B. mallei infections?

A methodological approach to evaluating BipB as a diagnostic antigen should include:

  • Expression and purification of recombinant BipB:

    • Clone the bipB gene from B. mallei into an expression vector

    • Express in a suitable system (e.g., E. coli)

    • Purify using affinity chromatography

    • Verify protein identity using mass spectrometry

  • Evaluation of immunogenicity and specificity:

    • Test using serum samples from:

      • Confirmed B. mallei infections

      • Confirmed B. pseudomallei infections

      • Other bacterial infections

      • Healthy controls

  • Diagnostic assay development and validation:

    • Develop an indirect ELISA format using purified recombinant BipB

    • Determine optimal antigen concentrations and test conditions

    • Calculate sensitivity, specificity, and predictive values

    • Compare performance with existing diagnostic methods

  • Cross-reactivity assessment:

    • Test against serum from animals exposed to related Burkholderia species

    • Evaluate potential for false positives from environmental exposures

What approaches can be used to study the role of BipB in host-pathogen interactions?

To investigate BipB's role in host-pathogen interactions, consider these methodological approaches:

  • Genetic manipulation strategies:

    • Create bipB gene knockout mutants

    • Develop complemented strains with restored bipB function

    • Generate point mutations in functional domains

    • Create fluorescently tagged BipB for localization studies

  • Cell culture infection models:

    • Macrophage infection assays to measure:

      • Apoptosis induction (using annexin V-fluorescein isothiocyanate detection)

      • MNGC formation rates

      • Intracellular bacterial survival and replication

      • Cell-to-cell spread efficiency

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify host binding partners

    • Co-immunoprecipitation to confirm protein-protein interactions

    • BiFC (Bimolecular Fluorescence Complementation) to visualize interactions

  • Advanced microscopy techniques:

    • Confocal microscopy to track BipB localization during infection

    • Live-cell imaging to monitor dynamics of host-pathogen interactions

    • Super-resolution microscopy for detailed structural analysis

How can I differentiate between BipB-dependent and BipB-independent mechanisms of host cell apoptosis?

Differentiating between these mechanisms requires a systematic experimental approach:

  • Comparative analysis using multiple bacterial strains:

    • Wild-type B. mallei

    • bipB knockout mutant

    • Complemented mutant (with restored bipB function)

    • Other T3SS component mutants

  • Time-course experiments to assess apoptosis kinetics:

    • Early phase (1-6 hours post-infection)

    • Intermediate phase (6-12 hours)

    • Late phase (12-24 hours)

  • Molecular pathway analysis:

    • Examine activation of different apoptotic pathways:

      • Intrinsic pathway (mitochondrial) markers

      • Extrinsic pathway (death receptor) markers

      • Caspase activation profiles

  • Inhibitor studies:

    • Caspase inhibitors

    • Specific pathway blockers

    • T3SS inhibitors

Based on previous research with B. pseudomallei, we know that BipB contributes significantly to apoptosis induction, but a basal level of apoptosis (approximately 3.21% compared to 10.20% with wild-type) still occurs in bipB mutants, suggesting parallel mechanisms . A comprehensive experiment would measure multiple apoptotic markers at different time points using flow cytometry or fluorescence microscopy.

What are the key considerations when evaluating contradictory findings in BipB research?

When encountering contradictory findings in BipB research, a structured analytical approach is essential:

  • Systematic comparison of experimental variables:

    • Bacterial strains (clinical vs. laboratory)

    • Cell types or animal models used

    • Infection conditions (MOI, time points)

    • Measurement techniques

  • Methodological differences assessment:

    • Protein expression systems

    • Purification methods

    • Assay sensitivities

    • Data analysis approaches

  • Biological context evaluation:

    • Host species differences

    • Cell type-specific responses

    • Bacterial adaptation mechanisms

    • Environmental conditions

  • Reproducibility analysis:

    • Independent replication of key findings

    • Statistical power assessment

    • Blinded experimental design

    • Controls for batch effects

  • Integration of multiple data types:

    • Genomic information

    • Transcriptomic responses

    • Protein interaction data

    • In vivo vs. in vitro findings

This structured approach helps identify whether contradictions represent genuine biological complexity or methodological variations . For example, differences in apoptosis levels between studies may reflect varying infection conditions or cell types rather than actual contradictions about BipB function.

How can comparative genomics be leveraged to identify BipB-specific diagnostic targets for B. mallei?

A methodological framework for identifying BipB-specific diagnostic targets includes:

  • Comprehensive sequence analysis:

    • Collect bipB sequences from multiple B. mallei strains

    • Compare with B. pseudomallei, B. thailandensis, and other related species

    • Perform BLASTn and BLASTp searches against comprehensive databases

    • Identify regions unique to B. mallei BipB

  • Structural prediction and epitope mapping:

    • Generate protein structure models

    • Predict surface-exposed epitopes

    • Identify regions with high antigenicity

    • Assess conservation across B. mallei strains

  • Recombinant protein fragment production:

    • Design and clone gene fragments encoding unique regions

    • Express and purify protein fragments

    • Validate structural integrity

  • Immunological screening:

    • Test fragments against serum from:

      • B. mallei infected animals

      • B. pseudomallei infected animals

      • Negative controls

    • Quantify cross-reactivity

This approach has been successful for identifying other B. mallei-specific diagnostic targets despite the high genetic similarity with B. pseudomallei . The key is targeting regions that may have undergone specific adaptations in B. mallei during its evolution from B. pseudomallei.

What are the recommended protocols for expressing and purifying recombinant BipB protein?

A detailed methodological approach for recombinant BipB production includes:

  • Gene cloning and vector construction:

    • PCR amplification of the bipB gene from B. mallei genomic DNA

    • Restriction enzyme digestion and ligation into expression vector

    • Addition of affinity tag (His6, GST, or MBP) for purification

    • Verification by sequencing

  • Expression optimization:

    • Test multiple expression systems:

      • E. coli strains (BL21, Rosetta, Arctic Express)

      • Expression temperature (16°C, 25°C, 37°C)

      • Induction conditions (IPTG concentration, induction time)

    Expression SystemTemperatureIPTG ConcentrationInduction TimeYield (mg/L)
    E. coli BL2137°C1.0 mM4 hours2-3
    E. coli BL2125°C0.5 mM16 hours5-7
    E. coli Rosetta16°C0.2 mM20 hours8-10
  • Purification strategy:

    • Cell lysis (sonication or French press)

    • Affinity chromatography (Ni-NTA, glutathione, or amylose resin)

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography for final polishing

    • Buffer optimization to maintain protein stability

  • Quality control:

    • SDS-PAGE for purity assessment

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Circular dichroism for secondary structure analysis

    • Dynamic light scattering for aggregation assessment

  • Functional validation:

    • Binding assays with host cell components

    • Structural analysis by crystallography or cryo-EM if applicable

    • Activity assays relevant to known BipB functions

How should I design an ELISA-based diagnostic test using recombinant BipB?

A methodological framework for developing an ELISA-based diagnostic test includes:

  • Assay format selection:

    • Indirect ELISA: Coat plates with recombinant BipB, detect antibodies in test samples

    • Sandwich ELISA: Use capture and detection antibodies to identify BipB in samples

    • Competitive ELISA: Competition between sample and labeled antigen

  • Optimization protocol:

    • Coating concentration determination:

      • Test recombinant BipB at 0.5-10 μg/ml

      • Evaluate signal-to-noise ratio

    • Blocking buffer selection:

      • Compare BSA, milk protein, and commercial blockers

      • Assess background reduction

    • Sample dilution optimization:

      • Create dilution series of positive and negative samples

      • Determine optimal dilution for discrimination

    • Secondary antibody selection:

      • Test species-specific conjugates

      • Optimize concentration and incubation time

  • Validation methodology:

    • Sensitivity analysis using defined positive samples

    • Specificity testing against related bacterial infections

    • Cross-reactivity assessment with B. pseudomallei antibodies

    • Receiver Operating Characteristic (ROC) curve analysis

    • Determination of optimal cutoff values

  • Reproducibility testing:

    • Intra-assay variation (within plate)

    • Inter-assay variation (between plates)

    • Lot-to-lot consistency

    • Stability studies under different storage conditions

This methodological approach has been successfully used for other recombinant Burkholderia proteins in diagnostic development .

What statistical approaches are most appropriate for analyzing BipB mutant virulence data?

When analyzing virulence data from BipB mutant studies, these statistical approaches are recommended:

  • For in vitro assays comparing wild-type, mutant, and complemented strains:

    • One-way ANOVA with post-hoc tests (Tukey or Dunnett) for normally distributed data

    • Kruskal-Wallis with Dunn's post-test for non-parametric data

    • Two-way ANOVA when examining multiple variables (e.g., time and strain)

    • Repeated measures analysis for time-course experiments

  • For animal infection studies:

    • Kaplan-Meier survival analysis with log-rank test

    • Cox proportional hazards model for multivariate analysis

    • Area under the curve (AUC) analysis for bacterial load data

    • Mixed-effects models for longitudinal measurements

  • Sample size determination:

    • Power analysis based on expected effect size

    • Consideration of biological variation

    • Adjustment for multiple comparisons

    • Estimation of dropout rates in animal studies

  • Data visualization:

    • Box plots for distribution comparison

    • Scatter plots with means for individual data points

    • Survival curves for time-to-event data

    • Heat maps for multivariate data

For example, when analyzing apoptosis data from macrophage infection studies, the differences between wild-type (10.20%), bipB mutant (3.21%), and complemented strain (6.77%) would typically be analyzed using one-way ANOVA followed by Tukey's multiple comparison test .

What are promising approaches for using BipB as a vaccine target against B. mallei infections?

Several methodological approaches show promise for BipB-based vaccine development:

  • Subunit vaccine strategies:

    • Full-length recombinant BipB

    • Immunogenic epitope-focused constructs

    • Multi-epitope chimeric proteins combining BipB with other antigens

    • Nanoparticle display of BipB epitopes

  • Delivery system optimization:

    • Adjuvant selection and formulation

    • Liposome or virus-like particle encapsulation

    • DNA vaccine encoding BipB

    • Prime-boost strategies combining different platforms

  • Protective efficacy assessment:

    • Challenge models in multiple animal species

    • Correlates of protection identification

    • Antibody and T-cell response characterization

    • Duration of immunity studies

  • Cross-protection evaluation:

    • Protection against diverse B. mallei strains

    • Potential cross-protection against B. pseudomallei

    • Assessment in different infection routes (aerosol, subcutaneous)

The development of BipB-based vaccines would benefit from comparative studies with other Burkholderia protein candidates and would need to address the challenge of generating both humoral and cell-mediated immunity for effective protection.

How can systems biology approaches enhance our understanding of BipB function in host-pathogen interactions?

Systems biology methodologies offer powerful approaches to understanding BipB function:

  • Multi-omics integration strategies:

    • Transcriptomics: RNA-seq of host cells infected with wild-type vs. bipB mutants

    • Proteomics: Comparative analysis of secreted and cellular proteins

    • Metabolomics: Metabolic changes in infected host cells

    • Phosphoproteomics: Signaling pathway activation differences

  • Network analysis approaches:

    • Protein-protein interaction networks altered by BipB

    • Regulatory network perturbations during infection

    • Pathway enrichment analysis of differential responses

    • Host-pathogen interactome mapping

  • Computational modeling:

    • Agent-based models of infection dynamics

    • Mathematical modeling of apoptosis pathways

    • Prediction of BipB structural interactions

    • Evolution of virulence factor function

  • Advanced single-cell techniques:

    • Single-cell RNA-seq of infected populations

    • Mass cytometry for multiparameter cellular analysis

    • Live-cell imaging with quantitative analysis

    • Spatial transcriptomics of infected tissues

These approaches could help elucidate how BipB orchestrates complex host-pathogen interactions and identify potential targets for therapeutic intervention beyond what conventional reductionist approaches have revealed.

What are the common challenges in working with recombinant BipB and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant BipB:

  • Protein solubility issues:

    • Problem: BipB forms inclusion bodies in expression systems

    • Solutions:

      • Lower expression temperature (16-20°C)

      • Use solubility-enhancing fusion tags (MBP, SUMO)

      • Optimize induction conditions (lower IPTG, longer time)

      • Co-express with chaperones

      • Consider cell-free expression systems

  • Protein stability concerns:

    • Problem: Purified BipB loses activity during storage

    • Solutions:

      • Screen buffer conditions (pH, salt, additives)

      • Add stabilizing agents (glycerol, trehalose)

      • Aliquot and flash-freeze

      • Consider lyophilization

      • Test activity immediately after purification as baseline

  • Immunological cross-reactivity:

    • Problem: Antibodies cross-react with B. pseudomallei BipB

    • Solutions:

      • Focus on unique epitopes

      • Perform epitope mapping

      • Absorb antisera with heterologous proteins

      • Use monoclonal antibodies for specificity

      • Develop competitive assays that can distinguish subtle differences

  • Reproducibility in biological assays:

    • Problem: Variable results in cell-based assays

    • Solutions:

      • Standardize protein lot quality

      • Control endotoxin contamination

      • Establish consistent cell culture conditions

      • Include multiple controls in each experiment

      • Develop quantitative readouts rather than qualitative assessments

These troubleshooting approaches have been derived from general recombinant protein work and specific challenges noted in Burkholderia virulence factor studies.

How can I address contradictory findings between in vitro and in vivo BipB studies?

When reconciling contradictions between in vitro and in vivo findings, consider this methodological framework:

  • Systematic comparison of experimental conditions:

    • In vitro models used (cell lines, primary cells, co-cultures)

    • In vivo models (animal species, routes of infection)

    • Bacterial growth conditions prior to experiments

    • Infection doses and time points examined

  • Comprehensive phenotypic analysis:

    • Multiple readouts of virulence and pathogenesis

    • Temporal dynamics of infection

    • Organ/tissue-specific effects

    • Immune response characterization

  • Mechanistic investigation approaches:

    • Ex vivo analysis of infected tissues

    • Adoptive transfer experiments

    • Conditional knockout models

    • Humanized animal models

  • Translational relevance assessment:

    • Correlation with clinical observations

    • Comparison with natural host responses

    • Evaluation in multiple model systems

    • Consideration of host genetic background effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.