Recombinant Burkholderia mallei UPF0060 membrane protein BMA0761 (BMA0761)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BMA0761; UPF0060 membrane protein BMA0761
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia mallei (strain ATCC 23344)
Target Names
BMA0761
Target Protein Sequence
MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Uniprot No.

Target Background

Database Links

KEGG: bma:BMA0761

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are effective for producing recombinant BMA0761?

E. coli has been demonstrated as an effective expression system for recombinant BMA0761 production . When expressing this protein, researchers typically use N-terminal His-tagging to facilitate purification, as this approach allows for proper folding while maintaining the membrane protein's structural integrity .

The methodology typically involves:

  • Gene cloning into an appropriate expression vector with an N-terminal His-tag

  • Transformation into E. coli expression strains

  • Induction of protein expression under optimized conditions (temperature, IPTG concentration)

  • Cell harvesting and membrane protein extraction using detergents

  • Affinity chromatography purification using the His-tag

  • Quality assessment through SDS-PAGE (>90% purity is achievable)

Alternative expression systems, such as yeast or insect cells, have not been extensively documented for BMA0761 in the available literature.

What are the optimal storage conditions for recombinant BMA0761?

Recombinant BMA0761 protein requires specific storage conditions to maintain stability and functionality. The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the following conditions are recommended:

  • Store at -20°C or preferably -80°C

  • Add glycerol to a final concentration of 50% before aliquoting

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • For short-term use, working aliquots can be stored at 4°C for up to one week

The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

What purification methods are most effective for isolating BMA0761 while maintaining native conformation?

Purification of membrane proteins like BMA0761 presents unique challenges due to their hydrophobic nature and tendency to aggregate. Based on available data, the following methodological approach is recommended:

  • Initial extraction: Use mild detergents such as n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to solubilize the membrane fraction containing BMA0761

  • Affinity chromatography: Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

  • Buffer optimization: Maintain purification buffers with detergent concentrations above critical micelle concentration (CMC)

  • Size exclusion chromatography: As a polishing step to separate aggregates and improve homogeneity

  • Quality assessment: SDS-PAGE analysis consistently shows >90% purity is achievable

The purified protein should be maintained in buffer conditions that mimic the membrane environment, often including phospholipids or detergent micelles to preserve native conformation.

How can researchers accurately determine the transmembrane topology of BMA0761?

Determining the transmembrane topology of BMA0761 requires a combination of computational prediction and experimental validation approaches:

  • Computational prediction:

    • Hydropathy plot analysis indicates multiple transmembrane regions

    • Analysis of positively charged residue distribution, which correlates with transmembrane topology in bacterial inner membrane proteins

    • Identification of the conserved G-X(6)-G motif, which is frequently found in the fifth transmembrane helix of C-terminal domains of related proteins

  • Experimental validation methods:

    • Cysteine scanning mutagenesis combined with accessibility studies

    • Protease protection assays to identify exposed regions

    • Fluorescence resonance energy transfer (FRET) to determine proximity of domains

    • Cryo-electron microscopy, which has been successfully used for related membrane proteins showing asymmetric structures

  • Domain architecture analysis:

    • Related membrane proteins have shown 4+4 TM asymmetric structures

    • Non-metric multidimensional scaling can be applied to analyze domain similarity

These combined approaches provide a comprehensive assessment of the protein's orientation and integration within the membrane.

What is currently known about the biological function of UPF0060 family proteins like BMA0761?

The UPF0060 family, including BMA0761, remains functionally uncharacterized, but evidence suggests potential roles based on:

  • Evolutionary analysis:

    • UPF0060 proteins appear to have evolved from domain duplication events in the EamA family

    • There is evidence of functional specialization in nucleotide sugar transporters that occurred through ancient domain duplications

  • Structural similarities:

    • Membrane topology analysis suggests similarities to other bacterial transporters

    • The presence of conserved motifs like G-X(6)-G in transmembrane regions points to potential transport functions

  • Pathogen-host interactions:

    • Related proteins from B. pseudomallei have been identified inside infected macrophages

    • Some uncharacterized B. pseudomallei proteins have been implicated in virulence mechanisms

While direct functional data for BMA0761 is limited, research on related bacterial membrane proteins suggests potential roles in transport processes across the bacterial membrane, possibly of nucleotide sugars or related compounds, which could be essential for bacterial cell wall synthesis or other critical cellular processes.

What methods are most effective for studying protein-protein interactions involving BMA0761?

To investigate potential interaction partners of BMA0761, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Utilizing the His-tag for pull-down experiments

    • Anti-His antibodies can capture BMA0761 along with interacting proteins

    • Mass spectrometry analysis of co-precipitated proteins can identify interaction partners

  • Bacterial two-hybrid systems:

    • Modified from yeast two-hybrid but optimized for membrane proteins

    • Can detect interactions in the context of bacterial membranes

  • Cross-linking mass spectrometry:

    • Chemical cross-linking of proteins in their native environment

    • Digestion and analysis by mass spectrometry to identify cross-linked peptides

    • This approach has been successful in identifying bacterial proteins in infected host cells

  • FRET or BRET analysis:

    • Fusion of fluorescent or bioluminescent tags to study proximity

    • Particularly useful for membrane protein interactions in live cells

  • Surface plasmon resonance (SPR):

    • For in vitro validation of specific interactions

    • Requires purified protein in detergent micelles or nanodiscs

These methods can help reveal whether BMA0761 interacts with other bacterial proteins or possibly with host proteins during infection.

How does BMA0761 compare to similar proteins in the related pathogen Burkholderia pseudomallei?

Burkholderia mallei (glanders pathogen) and Burkholderia pseudomallei (melioidosis pathogen) are closely related bacterial species with similar virulence mechanisms. Comparing BMA0761 to B. pseudomallei proteins reveals:

  • Proteomic studies:

    • B. pseudomallei produces approximately 160 bacterial proteins inside infected RAW264.7 murine macrophages

    • Several uncharacterized proteins have been identified in this context, including BPSS1996 and BPSL2748

    • While BMA0761 itself has not been specifically identified in similar studies, related membrane proteins may serve similar functions

  • Virulence associations:

    • Mutations in uncharacterized B. pseudomallei genes like BPSS1996 resulted in approximately 55-fold higher LD50 in mouse models compared to wild type, suggesting roles in virulence

    • This highlights the potential importance of studying uncharacterized membrane proteins like BMA0761

  • Immunogenicity:

    • Some novel B. pseudomallei proteins are recognized by sera from infected animals

    • These proteins can localize to the bacterial surface

    • Similar studies with BMA0761 would be valuable to determine if it exhibits similar properties

Comparative genomic and proteomic approaches between these related pathogens could provide insights into the potential role of BMA0761 in B. mallei pathogenesis.

What experimental approaches can determine if BMA0761 plays a role in virulence or pathogenesis?

To evaluate the potential role of BMA0761 in B. mallei virulence, researchers should consider the following experimental strategy:

  • Gene knockout/mutation studies:

    • Generate BMA0761 deletion mutants or site-directed mutants

    • Compare virulence properties to wild-type B. mallei

    • Similar approaches with B. pseudomallei uncharacterized proteins revealed significant changes in LD50 values in animal models

  • In vitro infection models:

    • Infect macrophage cell lines (e.g., RAW264.7) with wild-type and mutant strains

    • Assess intracellular survival, replication rates, and host cell responses

    • Determine if BMA0761 is produced inside infected cells using proteomic approaches

  • Animal infection models:

    • Challenge appropriate animal models with wild-type and mutant strains

    • Determine 50% lethal dose (LD50) differences

    • Evaluate bacterial burden in tissues and histopathological changes

  • Immunological studies:

    • Test if convalescent sera from infected animals recognize BMA0761

    • Assess if BMA0761 elicits protective immune responses

    • Determine cellular localization using immunofluorescence techniques

  • Host response analysis:

    • Comparison of host protein expression in cells infected with wild-type versus BMA0761 mutants

    • Focus on chemokines and cytokines involved in controlling initial stages of infection

This comprehensive approach would provide strong evidence regarding the contribution of BMA0761 to B. mallei pathogenesis.

What evidence suggests that UPF0060 family proteins evolved through domain duplication events?

Evolutionary analysis of membrane protein families provides compelling evidence for domain duplication in the origins of UPF0060 family proteins:

  • Domain architecture analysis:

    • Non-metric multidimensional scaling reveals bipartitioning of domains that recapitulates whether they are first or second domains

    • Evidence suggests evolution from 4 TM units to paired or fused genes with fixed and opposite membrane orientation

  • Functional specialization:

    • The EamA family (previously called domain unknown function 6) appears to be the original family from which several transporter families evolved

    • Triose-phosphate transporters, DUF914, UDP-glucose/N-acetylglucosamine, and nucleotide sugar transporter families evolved from domain duplication events before the radiation of Viridiplantae

  • Motif conservation:

    • The G-X(6)-G motif is overrepresented in the fifth transmembrane helix of C-terminal domains

    • This suggests conservation of functional elements following duplication events

  • Asymmetric structures:

    • Some membrane protein families show anomalous ("asymmetric") structures

    • Analysis with DLP-SVM and TMHMM suggests 4+5, 4+2, and 3+5 TM architectures in relation to the DMT domain border

This evolutionary perspective provides a framework for understanding the potential functions of BMA0761 and related proteins.

How can computational modeling and structural prediction enhance our understanding of BMA0761 function?

Advanced computational approaches can significantly advance our understanding of BMA0761:

  • Homology modeling:

    • While direct structural data for BMA0761 is lacking, related membrane proteins with solved structures can serve as templates

    • Asymmetric 4+4 TM structures determined by cryo-electron microscopy in related proteins provide structural frameworks

  • Molecular dynamics simulations:

    • Simulations of BMA0761 in membrane environments can reveal dynamic properties

    • Potential ligand binding sites and conformational changes can be predicted

  • Evolutionary coupling analysis:

    • Co-evolving residues often indicate structural or functional relationships

    • This approach can predict residue contacts and functional sites

  • Transmembrane topology prediction:

    • Multiple algorithms (TMHMM, HMMTOP, Phobius) should be combined for consensus prediction

    • Distribution of positively charged residues correlates with transmembrane topology in bacterial inner membrane proteins

  • Functional annotation transfer:

    • Network-based approaches to infer function from better-characterized homologs

    • Integration of genomic context and gene neighborhood analysis

These computational approaches generate testable hypotheses about BMA0761 function that can guide experimental design and interpretation.

What are the optimal conditions for reconstituting BMA0761 for functional studies?

Successful reconstitution of membrane proteins like BMA0761 requires careful optimization:

  • Reconstitution buffers:

    • Tris/PBS-based buffer at pH 8.0 has been successfully used for storage

    • Addition of 6% trehalose improves stability

  • Solubilization and reconstitution protocol:

    • Initial reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of glycerol (recommended final concentration 50%) for stability

    • Brief centrifugation prior to opening to bring contents to the bottom of the vial

  • Lipid environment optimization:

    • For functional studies, reconstitution into liposomes with bacterial lipid composition

    • Detergent removal by dialysis or adsorption to bio-beads

  • Quality control:

    • Circular dichroism to confirm secondary structure

    • Size-exclusion chromatography to assess homogeneity

    • Functional assays appropriate to hypothesized transport activity

  • Stability considerations:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for maximum one week

    • Monitor protein degradation by SDS-PAGE

These optimized conditions provide the foundation for reliable functional characterization of BMA0761.

What experimental design would be most appropriate for testing potential transport functions of BMA0761?

To investigate the hypothesized transport function of BMA0761, researchers should consider:

  • Reconstitution into artificial membrane systems:

    • Preparation of proteoliposomes with purified BMA0761

    • Inside-out and right-side-out vesicle preparations to determine directionality

  • Transport assays with candidate substrates:

    • Based on relationships to nucleotide sugar transporters , test nucleotide sugars

    • Radiolabeled substrate uptake assays

    • Fluorescence-based transport assays with substrate analogs

  • Electrophysiological approaches:

    • Planar lipid bilayer recordings

    • Patch-clamp of giant liposomes containing BMA0761

    • Measurement of substrate-induced currents

  • Site-directed mutagenesis:

    • Target conserved residues in transmembrane regions

    • Focus on the G-X(6)-G motif in transmembrane helices

    • Assess effects on transport activity

  • Comparative studies:

    • Parallel analysis with related transporters of known function

    • Competition experiments with known substrates of related transporters

This multifaceted approach would provide compelling evidence regarding the transport function and substrate specificity of BMA0761.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.