Recombinant Burkholderia mallei UPF0060 membrane protein BMA10229_A0598 (BMA10229_A0598)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BMA10229_A0598; UPF0060 membrane protein BMA10229_A0598
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia mallei (strain NCTC 10229)
Target Names
BMA10229_A0598
Target Protein Sequence
MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia mallei and why is the UPF0060 membrane protein significant?

Burkholderia mallei is a Gram-negative, nonmotile, facultatively intracellular bacterium that causes glanders, a contagious disease primarily affecting horses, although mules and donkeys are also susceptible. B. mallei differs from most other bacteria in the Burkholderiaceae family as it is an obligate mammalian pathogen rather than a soil resident . The UPF0060 membrane protein (BMA10229_A0598) is one of the structural proteins that may have significance in the pathogenicity and survival of the bacterium, potentially serving as a diagnostic marker or therapeutic target for glanders, which remains endemic in parts of Asia, the Middle East, and Central and South America .

How does the recombinant BMA10229_A0598 protein differ from its native form?

The recombinant BMA10229_A0598 protein is produced through heterologous expression systems rather than being isolated directly from Burkholderia mallei. This approach allows for controlled production of the protein in a laboratory setting without the need to culture the pathogenic organism. While the amino acid sequence remains identical to the native protein, post-translational modifications may differ depending on the expression system used (bacterial, yeast, insect, or mammalian cells) . The recombinant form typically includes fusion tags to facilitate purification and may be partial rather than full-length depending on expression constraints related to membrane proteins .

What are the common challenges in expressing recombinant membrane proteins like BMA10229_A0598?

Expressing membrane proteins such as BMA10229_A0598 presents several significant challenges:

  • Hydrophobicity issues: The hydrophobic domains of membrane proteins can cause aggregation and misfolding during expression .

  • Translation initiation problems: Truncated products may result from proteolysis or improper translation initiation .

  • Toxicity to expression hosts: Membrane protein overexpression can disrupt host cell membranes, limiting yield .

  • Codon usage bias: Rare codons in the B. mallei sequence may reduce expression efficiency in heterologous systems .

  • Proper folding: Achieving native conformation is difficult outside the original membrane environment .

To overcome these challenges, researchers often use fusion tags on both ends of the protein to distinguish full-length proteins from truncated forms and optimize expression conditions based on protein sequence and secondary structure analysis .

What expression systems are optimal for producing functional recombinant BMA10229_A0598?

Selection of an appropriate expression system for BMA10229_A0598 requires careful consideration of multiple factors to ensure proper folding and functionality:

Expression SystemAdvantagesDisadvantagesSuitability for BMA10229_A0598
E. coliCost-effective, rapid growth, high yieldLimited post-translational modifications, inclusion body formationModerate; may require fusion partners and solubility tags
YeastEukaryotic processing, secretion possibleMedium yield, glycosylation patterns differ from mammalianGood; balanced option for membrane proteins
Insect cellsNear-native folding of complex proteinsHigher cost, longer production timeVery good; preferred for functional membrane proteins
Mammalian cellsNative folding and modificationsHighest cost, lowest yield, time-consumingExcellent; best for structural and functional studies

How can I validate the structural integrity of purified recombinant BMA10229_A0598?

Validating the structural integrity of membrane proteins like BMA10229_A0598 requires multiple complementary approaches:

  • SDS-PAGE and Western blotting: Confirms the expected molecular weight and immunoreactivity

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure elements (α-helices, β-sheets)

  • Fluorescence spectroscopy: Evaluates tertiary structure and stability

  • Thermal shift assays: Measures protein stability and proper folding

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determines oligomeric state and homogeneity

  • Cryo-electron microscopy or X-ray crystallography: Provides detailed structural information when feasible

Additionally, functional assays specific to the protein's known or predicted activity should be performed to confirm that the recombinant protein retains its native functionality .

What detergents and stabilization methods are most effective for maintaining BMA10229_A0598 stability during purification?

Membrane protein purification requires careful selection of detergents and stabilization methods:

Detergent/MethodPropertiesApplication in BMA10229_A0598 Purification
DDM (n-Dodecyl β-D-maltoside)Mild, non-ionic, widely usedInitial extraction from membranes
LMNG (Lauryl maltose neopentyl glycol)Low CMC, high stabilityLong-term storage and crystallization
GDN (Glyco-diosgenin)Cholesterol-like structureAlternative for maintaining native-like environment
NanodiscsLipid bilayer mimeticsFunctional studies requiring membrane environment
SMALPs (Styrene maleic acid lipid particles)Native lipid extractionPreserving native lipid interactions

For BMA10229_A0598, a typical purification workflow might involve initial extraction with 1% DDM, followed by buffer exchange to 0.01-0.05% LMNG for downstream applications. Stability can be further enhanced by adding specific lipids (POPC, POPE) and cholesterol during purification processes .

How can I design experiments to assess the role of BMA10229_A0598 in B. mallei pathogenicity?

Investigating the role of BMA10229_A0598 in B. mallei pathogenicity requires a multi-faceted approach:

  • Gene knockout studies: Create deletion mutants and assess virulence changes in cellular and animal models

  • Protein-protein interaction studies: Identify binding partners using techniques such as:

    • Co-immunoprecipitation (as demonstrated in case studies with other bacterial proteins)

    • Yeast two-hybrid screening

    • Proximity labeling (BioID, APEX)

  • Localization experiments: Determine subcellular localization using fluorescent protein fusions or immunofluorescence

  • Host response analysis: Assess immune recognition and inflammatory responses to purified BMA10229_A0598

  • Structural studies: Determine if the protein forms pores, channels, or other functional structures in membranes

These approaches should be integrated with genomic and transcriptomic data comparing pathogenic B. mallei with less virulent related species to contextualize the protein's role in disease mechanisms .

What are the key considerations when using recombinant BMA10229_A0598 for developing diagnostic assays for glanders?

Development of diagnostic assays using recombinant BMA10229_A0598 requires addressing several critical factors:

  • Specificity validation: Cross-reactivity testing against proteins from related Burkholderia species, particularly B. pseudomallei, which is closely related to B. mallei and produces cross-reactions in serological tests

  • Sensitivity optimization: Determination of minimal detectable concentration using confirmed positive samples

  • Format selection: Comparison of different assay formats (ELISA, lateral flow, microarray) for field versus laboratory applications

  • Epitope mapping: Identification of B. mallei-specific epitopes within BMA10229_A0598 that do not cross-react with other species

  • Validation against gold standards: Comparison with complement fixation test (CFT) and other internationally recognized tests

Research has shown that diagnostic tests using crude bacterial antigens often result in false positives and negatives. Using well-characterized recombinant proteins can significantly improve specificity, addressing a major challenge in glanders diagnosis .

How do I troubleshoot low expression yields of recombinant BMA10229_A0598?

When encountering low expression yields of BMA10229_A0598, consider the following troubleshooting strategies:

  • Codon optimization: Adapt the coding sequence to the preferred codon usage of the expression host

  • Expression construct modification:

    • Try different fusion tags (MBP, SUMO, Trx) to enhance solubility

    • Use both N- and C-terminal tags to identify full-length protein

    • Create truncated constructs removing problematic hydrophobic regions

  • Expression conditions optimization:

    • Test lower induction temperatures (16-20°C)

    • Reduce inducer concentration

    • Extend expression time

  • Host strain selection:

    • For E. coli, try strains specialized for membrane proteins (C41/C43, Lemo21)

    • For eukaryotic expression, compare different cell lines

  • Solubilization screening:

    • Test detergent panels for improved extraction efficiency

    • Consider detergent mixtures or novel solubilization agents

Implementing a systematic approach to these parameters, potentially using a design of experiments (DoE) methodology, can significantly improve expression yields .

What proteomic approaches can identify post-translational modifications in BMA10229_A0598?

Identification of post-translational modifications (PTMs) in BMA10229_A0598 requires sophisticated proteomic techniques:

  • Mass spectrometry-based approaches:

    • Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS)

    • Electron Transfer Dissociation (ETD) for labile modifications

    • Parallel Reaction Monitoring (PRM) for targeted PTM analysis

  • Enrichment strategies for specific PTMs:

    • Phosphorylation: Titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC)

    • Glycosylation: Lectin affinity chromatography or hydrazide chemistry

    • Ubiquitination: Antibody-based enrichment

  • Top-down proteomics: Analysis of intact protein to maintain PTM relationships

  • Site-directed mutagenesis: Confirmation of PTM sites by mutation and functional analysis

These approaches should be complemented with bioinformatic prediction tools to guide experimental design for PTM site identification. For membrane proteins like BMA10229_A0598, special attention must be paid to sample preparation to maintain protein solubility throughout the analytical workflow.

How can structural biology techniques be applied to understand BMA10229_A0598 function?

Several structural biology techniques can provide insights into BMA10229_A0598 function:

For membrane proteins like BMA10229_A0598, cryo-EM has become increasingly valuable due to advances in detector technology and image processing algorithms. Complementary computational approaches such as molecular dynamics simulations can further enhance structural insights by modeling the protein in a lipid bilayer environment .

What bioinformatic approaches can predict functional domains and interactions of BMA10229_A0598?

Computational prediction of BMA10229_A0598 functional characteristics can be achieved through:

  • Sequence-based predictions:

    • Homology modeling using related proteins with known structures

    • Conservation analysis across Burkholderia species

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Functional domain identification (InterPro, Pfam)

  • Structure-based predictions:

    • AlphaFold2 or RoseTTAFold for structure prediction

    • Molecular docking for potential ligand interactions

    • Electrostatic surface analysis for binding sites

  • Network-based approaches:

    • Protein-protein interaction network analysis

    • Gene neighborhood and co-expression correlation

    • Phylogenetic profiling to identify functional partners

These computational approaches should be validated through targeted experimental studies to confirm predictions. For UPF0060 family proteins like BMA10229_A0598, which have uncharacterized functions, integrative bioinformatic approaches are particularly valuable for generating testable hypotheses about their biological roles .

How can recombinant BMA10229_A0598 be utilized in vaccine development against glanders?

Recombinant BMA10229_A0598 offers several potential applications in vaccine development:

  • Subunit vaccine candidate: As a membrane protein, BMA10229_A0598 may be exposed on the bacterial surface and accessible to antibodies, making it a potential protective antigen

  • Adjuvant formulation optimization:

    • Testing different adjuvants (alum, oil-in-water emulsions, TLR agonists)

    • Evaluating delivery systems (liposomes, nanoparticles, virus-like particles)

  • Immunogenicity assessment:

    • T-cell epitope mapping to identify immunodominant regions

    • B-cell epitope prediction and validation

    • Evaluation of cross-protective potential against related Burkholderia species

  • Correlates of protection studies:

    • Antibody titer and isotype analysis

    • Cellular immunity profiling

    • Passive transfer experiments to assess protective efficacy of antibodies

Research involving other recombinant proteins from B. mallei has shown promise in producing specific immune responses, suggesting that well-characterized proteins like BMA10229_A0598 could contribute to next-generation vaccines against glanders .

What are the emerging technologies for studying membrane protein dynamics that could be applied to BMA10229_A0598?

Several cutting-edge technologies show promise for studying the dynamics of membrane proteins like BMA10229_A0598:

  • Time-resolved cryo-EM: Captures different conformational states by trapping the protein at various time points during function

  • Single-molecule FRET (smFRET): Measures distance changes between fluorophore-labeled residues during protein conformational changes

  • Native mass spectrometry: Analyzes intact membrane protein complexes with bound lipids and ligands

  • Microfluidic diffusional sizing: Determines hydrodynamic radius changes upon ligand binding

  • Serial femtosecond crystallography: Uses X-ray free electron lasers (XFELs) to study room-temperature structures without radiation damage

  • In-cell NMR spectroscopy: Studies membrane protein behavior in cellular environments

These technologies could provide unprecedented insights into BMA10229_A0598's conformational dynamics, interactions with other proteins or small molecules, and behavior in native-like membrane environments.

How might comparative studies between B. mallei and B. pseudomallei membrane proteins inform our understanding of BMA10229_A0598?

Comparative studies between membrane proteins from B. mallei and the closely related B. pseudomallei can provide valuable insights:

  • Evolutionary adaptation analysis: As B. mallei is considered a deletion clone of B. pseudomallei that lost over 1,000 genes , comparing the retained membrane proteins like BMA10229_A0598 can reveal adaptations specific to an obligate mammalian pathogen lifestyle

  • Host specificity determinants: Identifying structural and functional differences in orthologous membrane proteins may explain the different host ranges of these species

  • Diagnostic marker identification: Comparative sequence and structural analysis could reveal B. mallei-specific epitopes within BMA10229_A0598 for improved diagnostic specificity

  • Virulence mechanism elucidation: Functional comparisons may reveal how membrane proteins contribute to the different pathogenesis patterns observed between the two species

A systematic approach comparing expression, localization, interaction partners, and immunogenicity of BMA10229_A0598 between these species could provide significant insights into how membrane proteins contribute to the distinct biological characteristics of these closely related bacteria .

What are the most critical knowledge gaps regarding BMA10229_A0598 that require further research?

Several significant knowledge gaps exist regarding BMA10229_A0598 that warrant further investigation:

  • Functional characterization: The specific biological function of this UPF0060 family membrane protein remains largely unknown

  • Structural features: Detailed three-dimensional structure and membrane topology are not well characterized

  • Role in pathogenesis: The contribution of BMA10229_A0598 to B. mallei virulence and host interaction requires clarification

  • Immunological properties: The immunogenicity and potential as a diagnostic marker or vaccine candidate need systematic evaluation

  • Conservation and variation: The degree of conservation across Burkholderia strains and species, and the functional significance of any variations

Addressing these knowledge gaps would significantly advance our understanding of this protein and potentially contribute to improved diagnostic and therapeutic approaches for glanders .

What interdisciplinary approaches might accelerate research on BMA10229_A0598?

Progress in understanding BMA10229_A0598 could be accelerated through interdisciplinary collaborations:

  • Structural biology and computational biology: Combining experimental structure determination with advanced modeling to predict functional sites

  • Immunology and molecular microbiology: Integrating host response studies with bacterial genetics to understand pathogenesis mechanisms

  • Systems biology and proteomics: Placing BMA10229_A0598 within the context of the bacterial interactome and host-pathogen interaction networks

  • Synthetic biology and protein engineering: Developing modified versions with enhanced stability or altered functionality for various applications

  • Biophysics and molecular dynamics: Investigating membrane protein behavior in native-like environments

These interdisciplinary approaches could provide complementary perspectives and methodologies, potentially leading to breakthroughs in understanding this protein's role in B. mallei biology and pathogenesis .

How might advances in AI-based protein structure prediction impact research on proteins like BMA10229_A0598?

Recent advances in AI-based protein structure prediction, particularly AlphaFold2 and RoseTTAFold, have transformative implications for research on membrane proteins like BMA10229_A0598:

  • Accelerated structural insights: These tools can provide reasonably accurate structural models without the challenges of experimental structure determination

  • Improved function prediction: Structure-based function prediction becomes more accessible, potentially revealing the role of UPF0060 family proteins

  • Rational experimental design: Predicted structures can guide the design of site-directed mutagenesis, truncation constructs, and protein engineering strategies

  • Epitope mapping: Structural predictions facilitate identification of surface-exposed regions for diagnostic antibody development

  • Drug target evaluation: Assessment of potential binding pockets and druggability becomes possible even without experimental structures

The full impact of these AI tools on membrane protein research is still emerging, but they offer particular value for proteins like BMA10229_A0598 from pathogens where experimental work presents biosafety challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.