Recombinant Burkholderia mallei UPF0060 membrane protein BMA10247_0554 (BMA10247_0554)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BMA10247_0554; UPF0060 membrane protein BMA10247_0554
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia mallei (strain NCTC 10247)
Target Names
BMA10247_0554
Target Protein Sequence
MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia mallei UPF0060 membrane protein BMA10247_0554 and why is it significant for research?

Burkholderia mallei UPF0060 membrane protein BMA10247_0554 is a 110-amino acid membrane protein encoded by the BMA10247_0554 gene in the bacterial pathogen Burkholderia mallei. This protein belongs to the UPF0060 family (Uncharacterized Protein Family 0060), indicating that its precise function remains to be fully elucidated. The protein has been assigned UniProt ID A3MIN7 and has been successfully expressed as a recombinant protein with an N-terminal His-tag .

The significance of this protein stems from multiple factors. First, B. mallei is classified as a Tier 1 select agent due to its potential use as a bioterrorism agent, high virulence, and resistance to multiple antibiotics . The pathogen causes glanders, a disease primarily affecting equines that can be transmitted to humans with potentially fatal outcomes. Second, as a membrane protein, BMA10247_0554 may play critical roles in bacterial membrane integrity, transport functions, signaling, or host-pathogen interactions. Membrane proteins often serve as important drug targets, making BMA10247_0554 a potential candidate for therapeutic intervention. Understanding its structure and function could therefore contribute significantly to the development of countermeasures against B. mallei infections.

How does B. mallei differ from other Burkholderia species in microbiological identification?

Burkholderia mallei exhibits several distinctive microbiological characteristics that differentiate it from other Burkholderia species, particularly in clinical and research laboratory settings :

  • Morphology and growth characteristics:

    • B. mallei appears as small gram-negative coccobacilli (1.5-3 μm × 0.5-1 μm) with rounded ends

    • Forms smooth, gray, translucent colonies on blood agar plates (BAP) within 48 hours

    • Shows no hemolysis on blood agar and produces no distinctive odor

    • Grows weakly or not at all on MacConkey agar (MAC) within 48 hours

    • Does not produce pigment, even on Mueller Hinton agar

  • Biochemical properties:

    • Catalase-positive

    • Oxidase reactions are variable, but most strains test negative

    • Indole-negative

    • Resistant to polymyxin B and colistin

    • Susceptible to amoxicillin-clavulanic acid but resistant to penicillin

    • Non-motile (a key differentiating feature from the closely related B. pseudomallei)

    • Does not grow at 42°C

What biosafety considerations apply when working with recombinant B. mallei proteins?

Working with recombinant Burkholderia mallei proteins, including BMA10247_0554, requires careful biosafety considerations due to the pathogen's classification as a Tier 1 select agent and potential bioterrorism threat . The following biosafety guidelines should be implemented:

  • Regulatory compliance:

    • Adhere to CDC and USDA Select Agent Program regulations

    • Obtain necessary permits and approvals before initiating work

    • Complete required training for handling select agent-derived materials

    • Maintain proper documentation and inventory records

  • Risk assessment and containment:

    • Distinguish between work with live B. mallei (requiring Biosafety Level 3) versus recombinant proteins expressed in E. coli (typically Biosafety Level 2)

    • Conduct protein-specific risk assessments based on potential biological activity and toxicity

    • Use certified biosafety cabinets for procedures that may generate aerosols

    • Implement proper waste decontamination procedures through autoclaving or chemical disinfection

  • Personal protective equipment:

    • Wear appropriate PPE including laboratory coat, gloves, and eye protection

    • Consider respiratory protection when working with lyophilized preparations

    • Establish protocols for proper donning and doffing of PPE

  • Emergency protocols:

    • Develop specific spill protocols and exposure response procedures

    • Maintain appropriate decontamination materials in the laboratory

    • Establish clear communication channels for incident reporting

While recombinant BMA10247_0554 produced in E. coli may present lower risk than the intact pathogen, prudent biosafety practices remain essential due to the potential severity of B. mallei infections and the select agent status of the organism .

How is recombinant BMA10247_0554 protein expressed and purified for research applications?

Expression and purification of recombinant BMA10247_0554 follows a methodical approach optimized for membrane proteins :

  • Expression system selection:

    • E. coli serves as the preferred expression host

    • The full-length protein (amino acids 1-110) is expressed with an N-terminal His-tag to facilitate purification

    • Selection of appropriate expression vectors containing inducible promoters (typically T7 promoter systems)

  • Culture and induction conditions:

    • Transformed bacterial cultures are grown to optimal density

    • Protein expression is induced under controlled conditions

    • Reduced temperature induction (16-30°C) may enhance proper folding of membrane proteins

    • Induction times and inducer concentrations require optimization for maximum yield of properly folded protein

  • Cell harvesting and lysis:

    • Bacterial cells are harvested by centrifugation

    • Cell lysis is performed using methods suitable for membrane protein isolation

    • Inclusion of protease inhibitors prevents degradation during processing

  • Membrane fraction isolation:

    • Differential centrifugation separates the membrane fraction containing BMA10247_0554

    • Detergent solubilization of membranes releases the target protein

    • Selection of appropriate detergents is critical for maintaining protein structure and function

  • Affinity chromatography:

    • His-tagged protein is purified using Ni-NTA or similar metal affinity resins

    • Imidazole gradient elution yields purified protein

    • Buffer composition throughout purification must maintain membrane protein stability

  • Quality control assessments:

    • SDS-PAGE analysis confirms purity and expected molecular weight

    • Western blotting with anti-His antibodies verifies identity

    • Mass spectrometry provides definitive confirmation of protein sequence

This methodology yields a final product in the form of lyophilized powder that can be reconstituted for various research applications .

What are the optimal storage and reconstitution procedures for BMA10247_0554?

Proper storage and reconstitution of BMA10247_0554 are critical for maintaining protein integrity and functionality :

Storage Recommendations:

  • Short-term storage (up to one week):

    • Store at 4°C in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

    • Avoid repeated freeze-thaw cycles

  • Long-term storage:

    • Store at -20°C/-80°C

    • Aliquot to minimize freeze-thaw cycles

    • Add glycerol (5-50% final concentration, with 50% being optimal) for cryoprotection

    • Use screw-cap microcentrifuge tubes to prevent evaporation

Reconstitution Protocol:

  • Pre-reconstitution preparation:

    • Briefly centrifuge the lyophilized protein vial to bring contents to the bottom

    • Allow the vial to equilibrate to room temperature before opening

  • Reconstitution steps:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Mix gently by inversion or gentle swirling rather than vortexing

    • Allow complete dissolution before proceeding

  • Post-reconstitution handling:

    • For long-term storage after reconstitution, add glycerol to 50% final concentration

    • Aliquot into working volumes to prevent repeated freeze-thaw cycles

    • For repeated use, maintain small working aliquots at 4°C for up to one week

Adherence to these storage and reconstitution guidelines ensures maximal protein stability and activity for downstream research applications .

How can researchers design experiments to investigate BMA10247_0554 function?

Designing experiments to investigate the function of an uncharacterized membrane protein like BMA10247_0554 requires a systematic, multi-faceted approach :

Table 1: Experimental Design Framework for BMA10247_0554 Functional Analysis

Experimental ApproachMethodologyExpected OutcomesControls
Genetic manipulationCreation of deletion mutants, insertional mutagenesis, or CRISPR-Cas9 editingPhenotypic changes indicating protein functionWild-type strain, complemented mutant
Protein-protein interactionsYeast two-hybrid screening, co-immunoprecipitation, pull-down assaysIdentification of interaction partners suggesting functional pathwaysEmpty vector controls, unrelated protein controls
Subcellular localizationFluorescent protein fusions, immunolocalization, membrane fractionationPrecise membrane localization and topologyMarkers for different membrane compartments
Phenotypic characterizationGrowth curves, stress resistance, biofilm formation, motility assaysFunctional role in bacterial physiologyWild-type under identical conditions
Virulence assessmentCell infection models, animal challenge studies, immune response analysisRole in pathogenesis and host interactionAttenuated strains, known virulence factor mutants

When designing these experiments, researchers should consider several principles specific to membrane protein research :

  • Control groups should include:

    • Wild-type B. mallei strains under identical conditions

    • Complemented mutants to confirm phenotype specificity

    • Empty vector controls for recombinant expression

    • Unrelated membrane protein controls

  • Variables to manipulate:

    • Environmental conditions (pH, temperature, nutrients)

    • Host cell types for infection studies

    • Stress conditions to reveal conditional phenotypes

    • Protein expression levels and timing

  • Measurement parameters:

    • Growth rates and bacterial viability

    • Membrane integrity and permeability

    • Host cell responses (cytokine production, cell death)

    • Protein interaction strength and specificity

  • Statistical considerations:

    • Appropriate sample sizes for adequate statistical power

    • Multiple biological and technical replicates

    • Suitable statistical tests for data analysis

    • Control for multiple comparisons when necessary

This comprehensive experimental design framework enables systematic exploration of BMA10247_0554 function from multiple perspectives.

What techniques can determine the membrane topology of BMA10247_0554?

Determining the membrane topology of BMA10247_0554 requires specialized techniques that can reveal how the protein is oriented within the bacterial membrane:

Table 2: Membrane Topology Determination Methods for BMA10247_0554

TechniquePrincipleAdvantagesLimitations
Cysteine scanning mutagenesisSequential replacement of residues with cysteine and accessibility testing with thiol-reactive reagentsHigh resolution, detects water-accessible regionsLabor-intensive, requires functional protein
Reporter fusion analysisFusion of reporters (PhoA, GFP, LacZ) to protein termini or internal sitesDetermines cytoplasmic vs. periplasmic orientationMay affect protein folding, limited resolution
Protease protection assaysSelective digestion of exposed protein regionsSimple technique, provides domain orientationLimited to accessible regions, non-specific digestion possible
Substituted cysteine accessibility method (SCAM)Accessibility of engineered cysteines to membrane-impermeable reagentsDetermines transmembrane segment boundariesRequires cysteine-free background, extensive mutagenesis
Fluorescence resonance energy transfer (FRET)Energy transfer between fluorescent labels on specific protein regionsProvides distance constraints between domainsComplex interpretation, requires fluorescent labeling
Computational prediction validationExperimental verification of transmembrane topology predictionsGuides experimental design, integrates multiple data typesPredictions require experimental validation

Implementation of these techniques for BMA10247_0554 would follow this general workflow:

  • Initial computational prediction of transmembrane domains and orientation

  • Selection of key residues or domains for experimental analysis

  • Generation of reporter fusions or cysteine mutants at strategically selected positions

  • Experimental determination of cytoplasmic versus periplasmic exposure

  • Integration of multiple experimental approaches to build a consensus topology model

  • Correlation of topology with potential functional domains

Understanding the membrane topology of BMA10247_0554 would provide critical insights into its potential interactions with host factors, other bacterial proteins, or small molecules, helping to elucidate its function in B. mallei biology and pathogenesis .

How can protein-protein interaction studies reveal the function of BMA10247_0554?

Protein-protein interaction (PPI) studies offer powerful approaches to elucidate the function of uncharacterized proteins like BMA10247_0554 by revealing their molecular partners and potential involvement in cellular processes :

  • Yeast two-hybrid (Y2H) screening:

    • Expression of BMA10247_0554 as a bait protein fused to a DNA-binding domain

    • Screening against normalized host (human/murine) proteome libraries

    • Identification of potential host targets provides insights into pathogenesis mechanisms

    • Follow-up validation through co-immunoprecipitation or pull-down assays

  • Co-immunoprecipitation (Co-IP) and pull-down assays:

    • Generation of specific antibodies against BMA10247_0554 or utilization of the His-tag

    • Precipitation of protein complexes from bacterial lysates or infected host cells

    • Mass spectrometry identification of interacting partners

    • Verification through reciprocal pull-down experiments

  • Proximity-dependent labeling techniques:

    • Fusion of BMA10247_0554 with enzymes like BioID or APEX2

    • Labeling of proteins in close proximity within living cells

    • Identification of the spatial interactome in relevant cellular contexts

    • Detection of transient or weak interactions difficult to capture by traditional methods

  • Cross-linking mass spectrometry:

    • Chemical cross-linking of interacting proteins

    • Digestion and analysis of cross-linked peptides

    • Determination of specific binding interfaces and interaction sites

    • Integration with structural modeling for mechanistic insights

Previous research has demonstrated that similar approaches with other B. mallei proteins have successfully identified interactions with host proteins, revealing mechanisms of virulence and pathogenesis . For example, yeast two-hybrid screens against human and murine proteome libraries identified previously unknown virulence factors by characterizing their host protein targets.

The identification of BMA10247_0554 interaction partners would provide valuable clues about its potential roles in bacterial physiology and host-pathogen interactions, potentially revealing whether it contributes to virulence mechanisms such as adhesion, invasion, immune evasion, or intracellular survival.

What genetic approaches can determine if BMA10247_0554 contributes to virulence?

Determining the contribution of BMA10247_0554 to B. mallei virulence requires systematic genetic approaches coupled with appropriate infection models :

  • Generation of isogenic mutants:

    • Creation of unmarked deletion mutants through allelic exchange

    • Insertional inactivation using site-specific mutagenesis

    • CRISPR-Cas9 genome editing for precise modifications

    • Construction of complemented strains expressing the wild-type gene

  • In vitro virulence-associated phenotypes:

    • Assessment of growth in various media and stress conditions

    • Evaluation of biofilm formation capacity

    • Quantification of adherence to relevant host cell types

    • Measurement of resistance to host antimicrobial defenses

  • Cellular infection models:

    • Invasion and intracellular survival in macrophages or epithelial cells

    • Host cell cytotoxicity measurements

    • Phagosomal escape and cytosolic replication analysis

    • Quantification of inflammatory response induction

  • Animal infection studies:

    • BALB/c mouse aerosol challenge models

    • Bacterial burden quantification in target organs

    • Histopathological examination of infected tissues

    • Survival curve analysis comparing wild-type and mutant strains

  • Gene expression analysis:

    • Transcriptional profiling of wild-type and mutant strains

    • Determination of BMA10247_0554 expression during infection

    • Identification of co-regulated genes suggesting functional pathways

Research with similar B. mallei membrane proteins has revealed that not all proteins contribute equally to virulence . Some may play essential roles in pathogenesis, while others might be involved in basic bacterial physiology or environmental adaptation. Complementation studies, where the wild-type gene is reintroduced, are crucial to confirm that observed phenotypes are specifically due to the absence of BMA10247_0554 rather than polar effects or secondary mutations.

The generation of insertion mutants in the virulent B. mallei ATCC 23344 strain, followed by aerosol challenge of BALB/c mice, has proven effective for evaluating the virulence contribution of candidate proteins, as demonstrated in previous studies .

How can structural biology approaches enhance understanding of BMA10247_0554?

Structural biology approaches provide crucial insights into BMA10247_0554 function through determination of its three-dimensional structure and structural dynamics:

Table 3: Structural Prediction Workflow for BMA10247_0554

StageMethodsExpected OutcomesApplications
Primary analysisSequence alignment, hydrophobicity analysisIdentification of transmembrane regionsTopology prediction, construct design
Secondary structurePSIPRED, JPred, SWISS-MODELPrediction of alpha-helices, beta-sheetsDomain organization, structural classification
Tertiary structureAlphaFold2, I-TASSER, Rosetta3D model with estimated confidence scoresFunctional site identification, interaction modeling
RefinementMolecular dynamics, energy minimizationOptimized structure in membrane environmentMore accurate representation of native state
ValidationPROCHECK, MolProbity, ERRATAssessment of model quality and reliabilityConfidence in downstream analyses
Functional mappingConSurf, SiteMap, CASTpIdentification of potential functional sitesTarget sites for mutagenesis and drug design

Understanding the structure of BMA10247_0554 would enable rational design of inhibitors, identification of critical functional residues, and mechanistic insights into its role in bacterial biology and host-pathogen interactions.

What approaches can assess BMA10247_0554 as a potential therapeutic target?

Evaluating BMA10247_0554 as a potential therapeutic target against B. mallei infections requires multidisciplinary approaches combining target validation, drug discovery, and preclinical assessment:

  • Target validation strategies:

    • Essentiality assessment through conditional knockdown or knockout systems

    • Virulence contribution analysis in relevant infection models

    • Conservation analysis across B. mallei strains and related pathogens

    • Absence or significant divergence from human homologs

  • Drug discovery approaches:

    • Structure-based virtual screening against the protein's binding sites

    • Fragment-based screening to identify chemical starting points

    • High-throughput functional assays if protein function is known

    • Phenotypic screening against whole bacteria with target engagement confirmation

  • Binding site identification:

    • Computational pocket detection algorithms

    • Evolutionary conservation analysis to identify functional sites

    • Experimental mapping through mutagenesis and activity assays

    • Probe-based NMR or mass spectrometry for ligand binding

  • Lead compound evaluation:

    • Direct binding assays (thermal shift, SPR, ITC)

    • Functional inhibition assessment if activity is known

    • Antibacterial activity against B. mallei and specificity testing

    • Cytotoxicity evaluation in mammalian cell models

  • In vivo efficacy studies:

    • Pharmacokinetic and biodistribution analysis

    • Efficacy in murine models of B. mallei infection

    • Combination studies with existing antibiotics

    • Resistance development assessment

Since B. mallei is classified as a potential bioterrorism agent with limited treatment options, membrane proteins like BMA10247_0554 represent attractive targets for therapeutic development . Membrane proteins often form channels, transporters, or signaling complexes that are accessible to drugs and critical for bacterial survival or virulence.

The development of inhibitors targeting BMA10247_0554 would benefit from comprehensive target validation to ensure that modulating this protein would effectively impair bacterial viability or virulence. Given the bioterrorism potential of B. mallei, therapeutic development against novel targets remains a priority for biodefense preparedness .

How should researchers interpret conflicting experimental results with BMA10247_0554?

When faced with conflicting experimental results regarding BMA10247_0554 function or characteristics, researchers should employ a systematic approach to reconcile discrepancies:

  • Methodological evaluation:

    • Compare experimental conditions between conflicting studies

    • Assess differences in protein preparation (tags, purification methods)

    • Evaluate assay sensitivity, specificity, and limitations

    • Consider statistical power and experimental design differences

  • Biological context considerations:

    • Examine strain-specific variations in BMA10247_0554 sequence or expression

    • Consider growth conditions that might affect protein function

    • Evaluate potential environmental triggers for conditional functions

    • Assess protein modifications or processing differences

  • Technical verification approaches:

    • Replicate experiments with standardized protocols

    • Employ orthogonal methods to test the same hypothesis

    • Increase biological and technical replication

    • Implement more stringent controls

  • Data integration strategies:

    • Combine multiple datasets through meta-analysis techniques

    • Weight evidence based on methodological rigor

    • Develop models that accommodate apparently contradictory findings

    • Consider context-dependent functions as explanations

  • Collaborative resolution:

    • Engage with other laboratories for independent verification

    • Share reagents, protocols, and raw data for comparative analysis

    • Design definitive experiments addressing specific contradictions

    • Consider multi-laboratory standardized studies

Conflicting results with membrane proteins like BMA10247_0554 are particularly common due to challenges in maintaining native conformations during extraction, purification, and experimental manipulation. Additionally, membrane proteins often exhibit context-dependent functions based on lipid environments or interaction partners.

When publishing research on BMA10247_0554, transparent reporting of methodology, clear acknowledgment of limitations, and comprehensive description of experimental conditions are essential to facilitate reconciliation of apparently conflicting findings across the research community.

What bioinformatic approaches can predict functions of uncharacterized proteins like BMA10247_0554?

Bioinformatic approaches offer powerful methods to predict functions of uncharacterized proteins like BMA10247_0554 when experimental data is limited:

  • Sequence-based analyses:

    • Homology detection using PSI-BLAST, HHpred, or HMMER

    • Identification of conserved domains or motifs through InterProScan

    • Transmembrane topology prediction using TMHMM or Phobius

    • Signal peptide prediction with SignalP

  • Structural prediction and analysis:

    • Tertiary structure prediction through AlphaFold2 or I-TASSER

    • Binding site prediction and characterization

    • Structural similarity searches against function-annotated proteins

    • Molecular dynamics simulations in membrane environments

  • Genomic context analysis:

    • Operon structure and co-transcribed genes

    • Conserved genomic neighborhoods across bacterial species

    • Gene fusion events suggesting functional relationships

    • Presence/absence patterns correlated with specific phenotypes

  • Network-based approaches:

    • Guilt-by-association methods using co-expression data

    • Protein-protein interaction network analysis

    • Phylogenetic profiling to identify co-evolving genes

    • Text mining of scientific literature for implicit connections

  • Integrated function prediction:

    • Machine learning approaches combining multiple features

    • Consensus methods integrating various prediction algorithms

    • Bayesian integration of diverse data types

    • Cross-validation against experimentally characterized homologs

For B. mallei UPF0060 membrane protein BMA10247_0554, these approaches might reveal potential functions related to membrane integrity, transport, signaling, or host interaction based on evolutionary relationships, structural features, and genomic context. While computational predictions require experimental validation, they provide valuable hypotheses to guide focused experimental design and prioritize research directions.

How can researchers assess the potential role of BMA10247_0554 in host-pathogen interactions?

Investigating the potential role of BMA10247_0554 in host-pathogen interactions requires a combination of computational predictions, in vitro models, and in vivo validation approaches :

  • Computational host interaction predictions:

    • Sequence-based identification of host-binding motifs

    • Structural modeling of potential interactions with host proteins

    • Comparison with characterized bacterial virulence factors

    • Prediction of immunogenic epitopes or immune evasion features

  • In vitro host cell models:

    • Infection assays comparing wild-type and BMA10247_0554 mutants

    • Measurement of adhesion, invasion, and intracellular survival

    • Assessment of host cell responses (cytokine production, cell death)

    • Localization studies during infection using immunofluorescence

  • Direct interaction studies:

    • Yeast two-hybrid screening against host proteome libraries

    • Pull-down assays with recombinant BMA10247_0554

    • Surface plasmon resonance to quantify binding to candidate partners

    • ELISA-based binding assays with purified host proteins

  • Immune response analysis:

    • Evaluation of BMA10247_0554 recognition by pattern recognition receptors

    • T-cell and antibody response characterization

    • Inflammasome activation assessment

    • Immunomodulatory effects on host cell signaling

  • In vivo infection models:

    • BALB/c mouse aerosol challenge models

    • Comparison of wild-type and mutant strain pathogenicity

    • Tissue burden and histopathological analysis

    • Immune response profiling in infected animals

Previous research with B. mallei has employed yeast two-hybrid assays against normalized whole human and murine proteome libraries to successfully identify interactions between bacterial proteins and host targets . This approach has revealed previously unknown virulence factors and their mechanisms of action. Similar strategies applied to BMA10247_0554 could elucidate whether this membrane protein directly interacts with host components during infection.

The identification of specific host interactions would provide valuable insights into BMA10247_0554's potential role in pathogenesis and might reveal novel therapeutic targets for intervention strategies against B. mallei infections.

What criteria determine if BMA10247_0554 should be prioritized for further research?

Prioritizing BMA10247_0554 for further research requires evaluation against several key criteria that assess its scientific significance and potential applications:

Table 4: Research Prioritization Matrix for BMA10247_0554

CriterionAssessment MetricsHigh Priority IndicatorsData Sources
EssentialityGrowth impact of gene deletion, Fitness in various conditionsSevere growth defects, Conditionally essentialMutagenesis studies, Transposon sequencing
Virulence contributionAttenuation in infection models, Host response alterationSignificant virulence reduction, Altered immune evasionAnimal infection studies, Cell-based assays
ConservationPresence across strains, Sequence conservationHighly conserved across B. mallei isolatesComparative genomics, Sequence databases
UniquenessAbsence in mammalian hosts, Divergence from commensal bacteriaNo close human homologs, Pathogen-specific featuresHomology searches, Phylogenetic analysis
DruggabilityPresence of binding pockets, Accessibility to drugsMembrane-accessible domains, Well-defined binding sitesStructural analysis, Bioinformatic prediction
Technical feasibilityEase of expression, Assay development potentialStable recombinant expression, Measurable activityProtein production data, Available assays
Translational potentialRelevance to countermeasure developmentPotential vaccine antigen or drug targetImmunogenicity data, Inhibition studies

Research prioritization should consider the broader context of B. mallei as a potential bioterrorism agent and the current gaps in therapeutic and diagnostic approaches . High-priority characteristics would include evidence that BMA10247_0554:

  • Contributes significantly to bacterial virulence or survival

  • Offers novel insights into B. mallei pathogenesis mechanisms

  • Represents a potential target for therapeutic development

  • Provides diagnostic or vaccine possibilities

Systematic evaluation against these criteria would help determine whether BMA10247_0554 warrants intensive research focus compared to other B. mallei proteins. Given the pathogen's significance as a potential bioterrorism agent and the limited treatment options available, proteins that offer potential for countermeasure development would typically receive higher prioritization .

What are the current knowledge gaps regarding BMA10247_0554?

Despite the availability of basic information about Burkholderia mallei UPF0060 membrane protein BMA10247_0554, significant knowledge gaps remain that limit our understanding of its biological role and potential applications. These gaps represent important opportunities for future research:

  • Functional characterization: The precise biological function of BMA10247_0554 remains undetermined, as indicated by its UPF0060 (Uncharacterized Protein Family) designation .

  • Structural information: While amino acid sequence is available, three-dimensional structural data is lacking, limiting structure-based functional predictions and drug design efforts .

  • Role in pathogenesis: Whether BMA10247_0554 contributes to B. mallei virulence, and through what mechanisms, remains to be established through systematic mutant studies .

  • Host interactions: Potential interactions with host cellular components, including possible roles in adhesion, invasion, or immune modulation, have not been characterized .

  • Regulation and expression: Conditions regulating BMA10247_0554 expression during infection or environmental stress remain unexplored.

  • Conservation and variation: While the protein is identified in B. mallei reference strains, its conservation across clinical and environmental isolates needs further investigation.

  • Membrane topology: The precise arrangement of transmembrane segments and orientation within the bacterial membrane requires experimental confirmation.

Addressing these knowledge gaps would provide valuable insights into B. mallei biology and potentially reveal new approaches for diagnostic, therapeutic, or preventive interventions against this significant biothreat pathogen .

What are the recommended future research directions for BMA10247_0554?

Based on current knowledge and identified gaps, several promising research directions could advance understanding of BMA10247_0554 and its potential applications:

  • Comprehensive functional characterization:

    • Generate and phenotype clean deletion mutants in B. mallei

    • Evaluate the impact on bacterial physiology, stress responses, and virulence

    • Identify conditions where the protein becomes essential or conditionally important

  • Structural biology approaches:

    • Determine high-resolution structure through crystallography or cryo-EM

    • Validate membrane topology through experimental methods

    • Identify potential ligand binding sites or interaction interfaces

  • Host-pathogen interaction studies:

    • Perform systematic screening for host protein interactions

    • Evaluate the impact on host cell processes during infection

    • Determine if BMA10247_0554 is exposed to the host immune system

  • Therapeutic potential assessment:

    • Evaluate as a potential drug target through essentiality and druggability analysis

    • Develop high-throughput screening assays if functional readouts are established

    • Explore immunogenic potential for vaccine development

  • Evolutionary and comparative studies:

    • Compare with homologs in related pathogens and environmental Burkholderia species

    • Identify selective pressures shaping protein evolution

    • Determine if horizontal gene transfer has influenced distribution

  • Systems biology integration:

    • Place BMA10247_0554 within bacterial protein interaction networks

    • Identify co-regulated genes through transcriptomic studies

    • Develop predictive models for protein function based on multiple data types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.