Recombinant Burkholderia multivorans Glycerol-3-phosphate acyltransferase (plsY)
Description
Enzyme Overview
PlsY catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), the first committed step in phospholipid biosynthesis . In Burkholderia multivorans, this enzyme is encoded by the plsY gene (locus tag: BMUL_0740 or Bmul_0740) , which is essential for membrane lipid assembly and bacterial viability.
Recombinant Production
Recombinant PlsY is expressed in Escherichia coli with a His-tag for purification . Key specifications include:
The amino acid sequence (UniProt ID: A9AGJ3) is:
MQILLAALIAYLIGSVSFAVIVSAAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLIGD AFKGWIAVWLARRYGLPDVAIAWVAIAVFIGHLYPVFFRFQGGKGVATAAGVLLAVHPVL GLATALTWLIIAFFFRYSSLAALVAAVFAPLFDVFLFGTNHNPIAWAVLAMSVLLVWRHR GNIAKLLAGEESRIGDKKKAAANGNAQDGGKA .
Functional Role in Bacterial Physiology
PlsY is a key regulator of fatty acid metabolism in B. multivorans, influencing membrane structure and antibiotic resistance mechanisms. While no direct studies on recombinant PlsY were found, genomic analyses of B. multivorans highlight:
-
Antibiotic Resistance Associations: Mutations in lipid biosynthesis genes (e.g., fabD) are linked to chronic infections in cystic fibrosis patients . Though plsY itself is not directly implicated, its role in membrane integrity may indirectly affect drug uptake .
-
Genetic Diversity: B. multivorans exhibits extensive recombination and mutation in stress-response pathways, potentially modulating enzymes like PlsY under selective pressure .
Research Applications
Recombinant PlsY is primarily used to:
-
Study bacterial lipid biosynthesis pathways.
-
Screen inhibitors targeting Gram-negative pathogens.
-
Investigate membrane biophysics in Burkholderia species.
Unresolved Questions
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your request.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: bmj:BMULJ_02520
STRING: 395019.BMULJ_02520
