Recombinant Burkholderia multivorans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; Bmul_0782; BMULJ_02478; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia multivorans (strain ATCC 17616 / 249)
Target Names
lspA
Target Protein Sequence
MAKTLSKPASGALAPWLGISLIVILFDQLSKIAILKTFAYGAQHALTSFFNLVLVYNRGA AFGFLSTASGWQRWAFTALGVGATLVICFLLKRHGHQRLFSLSLALILGGALGNVIDRLV YGHVIDFLDFHLGGWHFPAFNLADSAITIGAVLLIYDELRRVRGAR
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia multivorans Lipoprotein signal peptidase (lspA) and what is its biological significance?

Lipoprotein signal peptidase (lspA) is an essential membrane-bound aspartyl protease that functions in the bacterial lipoprotein processing pathway. In Burkholderia multivorans, lspA catalyzes the cleavage of the transmembrane helix signal peptide from lipoproteins after they have been lipidated by lipoprotein diacylglyceryl transferase (Lgt) . This processing step is crucial for the proper localization and function of bacterial lipoproteins.

The biological significance of lspA stems from its essential nature in Gram-negative bacteria and its importance for virulence in Gram-positive bacteria . In the Burkholderia cepacia complex (Bcc), which includes B. multivorans, proper lipoprotein processing is critical for cell envelope integrity, bacterial survival during infection, and pathogenesis, particularly in cystic fibrosis (CF) patients .

Methodologically, studies examining knockout mutants have revealed that while some lspA homologs (like AmpC1) demonstrate weak β-lactamase activity, the deletion of lspA genes can significantly impact bacterial fitness and virulence capabilities .

What expression systems and purification methods are recommended for recombinant B. multivorans lspA?

Expression and purification of recombinant B. multivorans lspA require specialized approaches due to its nature as a membrane protein. Based on successful protocols with homologous proteins, the following methodological approach is recommended:

Expression System:

  • Host: E. coli C41(DE3) strain, which is optimized for membrane protein expression

  • Vector: pET28a or similar with an N-terminal 6×His-tag and thrombin cleavage site

  • Construction: The lspA gene can be cloned using restriction sites (NdeI and XhoI have been successful for homologous proteins)

Purification Protocol:

  • Cell lysis using French press or sonication in buffer containing protease inhibitors

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization with appropriate detergents (LMNG or FC12 have been effective)

  • Affinity chromatography using Ni-NTA resin

  • Optional thrombin cleavage to remove the His-tag

  • Size exclusion chromatography for final purification

Storage Conditions:

  • For short-term: Tris-based buffer at 4°C

  • For long-term: 50% glycerol at -20°C or -80°C

This approach has been successful for homologous proteins, yielding pure protein suitable for biochemical and structural studies .

How can enzymatic activity of recombinant B. multivorans lspA be assessed in vitro?

The enzymatic activity of recombinant B. multivorans lspA can be assessed using several complementary approaches:

Gel-Shift Activity Assay

This coupled assay measures the cleavage of a lipoprotein substrate:

  • Pre-incubate a lipoprotein substrate (e.g., pre-proICP, 12 µM) with Lgt (1.2 µM) and lipids (DOPG, 250 µM) to generate the lipidated LspA substrate

  • Add purified lspA (0.5 µM) to initiate the reaction

  • Sample at timed intervals and stop reactions with SDS loading buffer

  • Analyze by SDS-PAGE, where substrate processing is visualized as a mobility shift

FRET-Based Assays

These assays employ fluorescently labeled peptide substrates:

  • Design peptides containing the conserved lipobox sequence with FRET pairs

  • Monitor fluorescence changes upon cleavage in real-time

  • Calculate kinetic parameters (Km, Vmax, kcat)

Inhibition Studies

For mechanistic insights and validation:

  • Use known inhibitors like globomycin or myxovirescin (0-3.2 mM concentration range)

  • Perform dose-response experiments to determine IC50 values

  • Analyze data using nonlinear regression

Mass Spectrometry

To verify cleavage site specificity:

  • Incubate labeled or unlabeled substrate with lspA

  • Analyze reaction products by MALDI-TOF or LC-MS/MS

  • Identify the precise cleavage site in the substrate

When performing these assays, it's critical to include appropriate controls (heat-inactivated enzyme, known inhibitors) and to optimize detergent conditions to maintain enzyme activity in the experimental buffer system .

What is the genetic organization of the lspA gene in B. multivorans and how can it be manipulated?

The lspA gene in B. multivorans is part of the essential bacterial lipoprotein processing pathway. Based on genomic studies of Burkholderia species, the following aspects of genetic organization and manipulation are important:

Genetic Organization:

  • In B. multivorans ATCC 17616, the lspA gene corresponds to the locus tag BMµL_0782 or BMµLJ_02478

  • The gene encodes a 166-amino acid protein

  • It is located within genetic contexts related to cell envelope biogenesis and membrane protein processing

Genetic Manipulation Methods:

  • CRISPR/Cas9-based editing: A modified two-plasmid system (pCasPA and pACRISPR) has been optimized for B. multivorans :

    • Allows precise, unmarked deletions

    • Enables targeted gene insertions

    • Requires only one step for allelic exchange, making it faster than traditional methods

  • Traditional allelic exchange:

    • Requires merodiploid formation and resolution through two independent homologous recombination events

    • More time-consuming but established methodology

  • Plasmid-based complementation:

    • For functional studies, lspA can be cloned into expression vectors using PCR amplification

    • Primers can be designed based on the genomic sequence with appropriate restriction sites

    • Expression can be driven by constitutive or inducible promoters

  • Reporter gene fusions:

    • GFP fusions have been successfully used in Burkholderia for visualization in confocal microscopy

    • Can be applied to study localization and expression patterns of lspA

These methodologies provide researchers with a toolkit for studying lspA function through gene knockouts, complementation, site-directed mutagenesis, and expression analysis .

What role does lspA play in the pathogenesis of B. multivorans infections, particularly in cystic fibrosis?

LspA plays a significant role in B. multivorans pathogenesis, especially in cystic fibrosis (CF) infections, through several mechanisms:

Lipoprotein Processing and Cell Envelope Integrity

  • As a lipoprotein signal peptidase, lspA processes lipoproteins essential for cell envelope integrity

  • Properly processed lipoproteins contribute to membrane stability, nutrient acquisition, and environmental adaptation

  • These functions are particularly important in the challenging CF lung environment with nutritional limitations and immune pressures

Evolution During Chronic Infection

  • During long-term colonization of CF lungs, B. multivorans undergoes genetic adaptation

  • Multiple lineages can coexist for years or decades within the same patient

  • Diversification periods correlate with deterioration of patient lung function

  • Genes involved in lipopolysaccharide (LPS) biosynthesis and membrane structure, which functionally interact with lipoprotein pathways, are under strong selective pressure

Relationship to Virulence Factors

  • LspA-processed lipoproteins contribute to:

    • Biofilm formation capabilities

    • Antimicrobial resistance mechanisms

    • Host immune evasion strategies

  • The LPS O-antigen, which interacts with membrane lipoproteins, influences resistance to serum-mediated killing and evasion of phagocytosis

Adaptation to CF Lung Environment

  • B. multivorans isolates from chronic infections show mutations in genes related to:

    • Oxidative stress response

    • Transition metal metabolism

    • Defense mechanisms against antibiotics

  • These adaptations reflect selective pressures from host immune responses, antibiotic therapy, and environmental conditions like low oxygen and iron

Understanding lspA's role in these pathogenic mechanisms provides potential targets for therapeutic intervention in chronic CF infections .

How does B. multivorans lspA compare to homologous enzymes in other bacterial species?

B. multivorans lspA shares structural and functional similarities with homologous enzymes from other bacterial species, but also exhibits important differences:

Sequence Comparison

SpeciesSequence Identity to B. multivorans lspALength (aa)Notable Features
B. vietnamiensisVery high (>90%)166Nearly identical active site residues
B. cenocepaciaHigh (>85%)166Under similar selective pressure during CF infection
P. aeruginosaModerate (~50-60%)164-169Used as model for LspA structural studies
S. aureus (MRSA)Low (~30-40%)~170Important for cell envelope integrity in Gram-positive context
Rickettsia typhiVery low (<30%)~240Contains conserved catalytic Asn, Asp, and Ala residues in boxes C and D

Functional Conservation and Divergence

  • Conformational Dynamics: Studies of P. aeruginosa LspA reveal flexibility in the periplasmic helix that may differ in B. multivorans based on sequence variations

  • Inhibitor Sensitivity: While most lspA homologs are inhibited by globomycin, the binding mode and sensitivity can vary between species

  • Substrate Specificity: The lipobox recognition sequences may have species-specific preferences reflecting adaptations to different ecological niches

  • Association with Virulence: In the Burkholderia cepacia complex, lspA plays a specialized role in adaptation to the CF lung environment not observed in non-CF pathogens

These comparative insights are valuable for understanding the evolution of lspA and for developing species-specific or broad-spectrum targeting strategies .

What are the current methodologies for studying the conformational dynamics of lspA?

Understanding the conformational dynamics of lspA is crucial for elucidating its mechanism and developing inhibitors. Current methodologies include:

Molecular Dynamics (MD) Simulations

  • Reveals nanosecond timescale fluctuations of the periplasmic helix

  • Identifies multiple conformational states (closed, intermediate, open)

  • Simulates protein behavior in membrane environments

  • Can model interactions with substrates and inhibitors

Electron Paramagnetic Resonance (EPR) Spectroscopy

  • Continuous-Wave (CW) EPR:

    • Performed on spin-labeled lspA in detergent micelles

    • Reveals room-temperature dynamics

    • Shows characteristic two-component line shapes indicating conformational exchange

  • Double Electron-Electron Resonance (DEER):

    • Measures distances between labeled sites (5-80 Å range)

    • Identifies conformational distributions

    • Detects changes upon inhibitor binding

X-ray Crystallography

  • Provides high-resolution static structures

  • Has revealed antibiotic binding modes

  • Limited in capturing the full range of conformational states

Hybrid Experimental Approach

The most informative studies combine multiple techniques:

  • MD simulations predict conformations

  • EPR validates and refines these predictions

  • Functional assays correlate structural changes with activity

  • This approach has identified conformations not observed in crystal structures alone

A comprehensive experimental design involves:

  • Site-directed spin labeling at strategic positions

  • CW EPR to assess mobility at each site

  • DEER measurements between pairs of labeled sites

  • MD simulations constrained by experimental data

  • Correlation of conformational changes with functional states

This integrated approach has revealed that lspA exists in equilibrium between closed, intermediate, and open states, with the equilibrium shifted by substrate or inhibitor binding .

How do mutations in lspA affect B. multivorans virulence and adaptation during chronic infection?

Mutations in lspA and related pathways contribute significantly to B. multivorans adaptation during chronic infection, particularly in cystic fibrosis patients:

Evolutionary Patterns

Studies tracking B. multivorans evolution during chronic CF infections have revealed:

  • Accumulation rate of 2.27 SNPs/year in B. multivorans during chronic infection

  • Most mutations affecting cell envelope/wall/membrane biogenesis and regulatory pathways

  • Parallel evolution in genes related to lipoprotein processing and lipopolysaccharide biosynthesis

Adaptive Mechanisms

  • Lipopolysaccharide (LPS) Modifications:

    • Mutations in nucleotide sugar dehydratase (wbiI) involved in O-antigen biosynthesis

    • Loss of O-antigen correlates with increased survival in phagocytic cells

    • Two different O-antigen structures have been identified in clinical isolates, affecting virulence

  • Stress Response Adaptation:

    • Mutations in two-component regulatory sensor kinase systems that sense oxidative and heavy metal stress

    • These systems interact with lipoprotein processing pathways to coordinate envelope stress responses

  • Biofilm Formation:

    • Long-term evolution leads to altered biofilm production capacity

    • Mutations in diguanylate cyclase/phosphodiesterase RpfR, which regulates biofilm formation

    • These changes correlate with persistence in the CF lung environment

Clinical Significance

Evolutionary diversification within B. multivorans during infection has been directly associated with:

  • Deterioration of patient lung function

  • Development of multiple coexisting lineages that persist for years or decades

  • Increased antimicrobial resistance

  • Adaptation to nutritional limitations and immune pressures of the CF lung

These findings highlight the importance of lspA and related envelope processes in bacterial adaptation and suggest that targeting these pathways might prevent adaptive evolution during chronic infection .

What are the current approaches for targeting lspA as a potential therapeutic target?

LspA represents a promising antibiotic target due to its essential role in Gram-negative bacteria and importance for virulence in Gram-positive pathogens . Current approaches for targeting lspA include:

Natural Product Inhibitors

  • Globomycin: A cyclic peptide antibiotic that inhibits LspA

    • Binds to LspA and stabilizes an intermediate conformation

    • Prevents signal peptide cleavage and substrate binding

    • Serves as a reference compound for inhibitor development

  • Myxovirescin: Another natural product inhibitor

    • Can be used in dose-response assays (0-3.2 mM range)

    • Provides structural diversity for comparative studies

Structure-Based Drug Design

  • Utilizes crystal structures and MD simulations

  • Targets the conformational dynamics of LspA

  • Focuses on designing compounds that:

    • Lock the enzyme in inactive conformations

    • Compete with substrate binding

    • Disrupt catalytic aspartate residues

High-Throughput Screening Methods

  • Gel-shift activity assays: To identify compounds that inhibit prolipoprotein processing

  • FRET-based assays: For real-time monitoring of inhibition kinetics

  • Growth inhibition assays: To assess whole-cell activity of potential inhibitors

Antimicrobial Resistance Considerations

  • LspA inhibitors are promising because they target a pathway distinct from conventional antibiotics

  • No widespread resistance mechanisms against LspA inhibitors have been reported

  • The essential nature of the target makes development of resistance potentially costly to bacterial fitness

Species-Specific Considerations for B. multivorans

  • The unique adaptations of B. multivorans during chronic infection may affect inhibitor efficacy

  • Mutations in LPS biosynthesis pathways that interact with lipoprotein processing must be considered

  • The conformational flexibility of LspA suggests that combination approaches targeting multiple states may be most effective

The development of LspA-targeting therapeutics remains an active area of research with potential for addressing antimicrobial resistance in critical pathogens like B. multivorans .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.