Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Bmul_3154; BMULJ_00074; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
full length protein
Species
Burkholderia multivorans (strain ATCC 17616 / 249)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRSHGRPSMFFPSATQTAPAAAGGASGAGATTTAGNV PAPAAGTAPATTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITLF DHTAGHTYLARTGLLGGDFPNHNDVYTQVNAGPTSLSGDQNTLKLSFESPVKGGVKVVKT YTFTRGSYVIGVDTKIDNVGTTPVTPTLYMELVRDNTAVETPMFSHTFLGPAVYTDAKHF QKINFSDLDKNKADYVTSADNGWVAMVQHYFASAWIPQHGVKRDIYAEKIDPSLYRVGVK QPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHS YVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKNDPQKMNAALM ELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFILPV LMAVSMYVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYY ITRKLGGVKKKPA
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins within the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, including certain lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Burkholderia multivorans YidC protein?

Burkholderia multivorans YidC is a full-length membrane protein insertase consisting of 553 amino acid residues. The conserved membrane-integrated core forms a helical bundle arranged like the vertices of a pentagon, in the order 4-5-3-2-6 (when viewed from the cytoplasm), creating a distinctive pentagonal structure . The protein contains five conserved transmembrane domains (excluding the non-conserved first transmembrane helix TM1) and a periplasmic domain (P1) . When expressed recombinantly, it can be fused with tags such as an N-terminal His-tag to facilitate purification .

How does YidC function in membrane protein insertion?

YidC mediates membrane protein integration either independently as a membrane protein insertase or in concert with the SecY complex . Structural and functional analyses have revealed that YidC interacts with the ribosome at the ribosomal tunnel exit, creating a site for membrane protein insertion at the YidC protein-lipid interface . This architecture facilitates the co-translational mode of YidC-mediated membrane protein insertion. The protein creates a protected environment at the membrane interface where hydrophobic segments of nascent membrane proteins can be correctly oriented and inserted into the lipid bilayer.

What is known about the evolutionary conservation of YidC?

YidC is a universally conserved protein found across bacterial species. Evolutionary co-variation analysis has been used to predict contacts between pairs of YidC residues, revealing strongly conserved structural elements . These analyses have identified seven helix-helix contacts with probabilities above 57% that maintain the core architecture of the protein . The high degree of conservation reflects the essential role of YidC in bacterial physiology and membrane protein biogenesis.

What expression systems are recommended for recombinant B. multivorans YidC production?

The most effective expression system for recombinant B. multivorans YidC is Escherichia coli, which has been successfully used to produce functional protein . When expressing this membrane protein, it's critical to optimize conditions to prevent aggregation and ensure proper folding. The expression construct should include the full-length sequence (amino acids 1-553) with appropriate tags for purification, such as an N-terminal histidine tag . The expression should be performed under controlled conditions, with induction parameters optimized to maximize the yield of properly folded protein.

What are the optimal storage conditions for purified YidC protein?

Purified recombinant B. multivorans YidC should be stored in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard) and store at -20°C or -80°C in aliquots to avoid repeated freeze-thaw cycles . For working stocks, the protein can be kept at 4°C for up to one week . Prior to use, vials should be briefly centrifuged to bring contents to the bottom, and the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What reconstitution methods are most effective for functional studies of YidC?

For functional studies, YidC should be reconstituted into lipid bilayers or nanodiscs that mimic its native membrane environment. Based on research protocols, the following reconstitution method has proven effective:

  • Purify YidC with the appropriate detergent (typically a mild non-ionic detergent)

  • Mix with desired lipids at protein:lipid ratios between 1:50 and 1:200 (w/w)

  • Remove detergent using Bio-Beads or dialysis

  • Verify incorporation using techniques such as freeze-fracture electron microscopy

For ribosome-binding studies, reconstituted YidC can be incubated with purified ribosomes (typically 100 pmol of ribonucleoprotein complexes with 500 pmol of freshly purified YidC) for 30 minutes at 37°C . This approach has been successfully used in cross-linking experiments to understand YidC's interaction with nascent chains.

How can researchers analyze YidC-ribosome interactions experimentally?

Analysis of YidC-ribosome interactions can be performed using multiple complementary approaches:

  • Cryo-electron microscopy (cryo-EM): This technique has been successfully used to visualize YidC-ribosome complexes, revealing how a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit . For optimal results, reconstitute ribosome-nascent chain complexes (RNCs) with purified YidC and prepare grids using established cryo-EM protocols.

  • Disulfide crosslinking: Introduce single cysteine mutations in YidC (e.g., M430C and P431C in TM3, or V500C and T503C in TM5) and in the substrate protein (e.g., G23C in FOc) . After reconstitution, induce disulfide formation using 1 mM 5,5′-dithiobis-(2-nitrobenzoicacid) (DTNB) for 10 minutes at 4°C, quench with 20 mM N-Ethylmaleimide (NEM), and analyze by SDS-PAGE and western blotting .

  • Molecular dynamics simulations: Complement experimental approaches with MD simulations to analyze the stability and dynamic behavior of YidC-ribosome complexes .

What mutagenesis approaches can identify critical functional residues in YidC?

Based on structural models and molecular dynamics simulations, several key residues in YidC have been identified as functionally important. Researchers can employ site-directed mutagenesis using the following approach:

  • Identify candidate residues for mutagenesis:

    • Residues involved in ribosome contacts (e.g., Y370, Y377, D488)

    • Core stabilizing residues (e.g., T362 in TM2, Y517 in TM6)

    • Residues at the substrate-binding interface (e.g., residues in TM3)

  • Generate alanine substitutions or charge inversions (e.g., D488K)

  • Test functionality using in vivo complementation assays:

    • Express mutant YidC in a YidC-depletion strain (e.g., E. coli FTL10)

    • Evaluate growth under depletion conditions

    • Verify stable expression of mutant proteins by western blotting

This approach has successfully identified residues critical for YidC function, with mutations in T362, Y517, Y370, Y377, and D488 severely impairing YidC activity despite stable protein expression .

How does the structure of B. multivorans YidC compare with YidC from other bacterial species?

Comparative analysis of YidC structures across bacterial species reveals both conserved features and important differences:

FeatureB. multivorans YidCE. coli YidCOther Bacterial YidC
Core TM domains5 conserved TM domains in pentagonal arrangement5 conserved TM domains in similar arrangementGenerally 5 conserved TM domains
N-terminal regionContains non-conserved TM1Contains non-conserved TM1Variable across species
Periplasmic domainContains P1 domainContains P1 domainVariable size and structure
Cytoplasmic domainsIncludes helical paddle domain (HPD) between TM2 and TM3Similar HPD structureHPD is generally present but variable
Ribosome interactionInvolves residues Y370, Y377, D488Similar interaction sitesConserved ribosome binding mode

While the core structure and function are conserved, species-specific variations may reflect adaptations to different membrane compositions or substrate preferences. The evolutionary co-variation analysis approach used to model YidC can identify these conserved and variable regions across species .

Could YidC be targeted for antimicrobial development against B. multivorans?

YidC represents a potential target for novel antimicrobial development against B. multivorans due to several favorable characteristics:

  • Essential function: YidC is required for bacterial viability, making it an attractive target for antibacterial agents.

  • Conserved structure: The conserved structural elements identified through evolutionary analysis could serve as binding sites for inhibitors.

  • Accessibility: Key functional regions, such as the ribosome-binding interface or the substrate insertion site, could be targeted by small molecules or peptides.

  • Relevance to antibiotic resistance: B. multivorans exhibits complex patterns of antibiotic resistance and collateral sensitivity . Targeting YidC could potentially disrupt the membrane insertion of proteins involved in these resistance mechanisms.

Potential approaches for targeting YidC include:

  • Small molecules that disrupt YidC-ribosome interactions

  • Peptides that bind to the substrate insertion site

  • Compounds that destabilize critical residues identified through mutagenesis studies (e.g., T362, Y517)

How might YidC activity relate to antibiotic sensitivity patterns in B. multivorans?

B. multivorans exhibits complex patterns of antibiotic resistance, including collateral sensitivity (CS) where acquired resistance to one antibiotic results in decreased resistance to another . While direct links between YidC and specific antibiotic sensitivity patterns haven't been established, several potential connections exist:

  • YidC is responsible for inserting membrane proteins involved in drug efflux, uptake, and modification, which are key determinants of antibiotic sensitivity.

  • Alterations in YidC function could influence the composition and properties of the bacterial membrane, affecting the penetration of antibiotics.

  • The collateral sensitivity networks identified for B. multivorans with antibiotics like ceftazidime, chloramphenicol, levofloxacin, meropenem, minocycline, and trimethoprim-sulfamethoxazole may involve membrane proteins whose insertion depends on YidC.

Studies that combine YidC functional analysis with antibiotic susceptibility testing could reveal connections between YidC activity and specific antibiotic resistance mechanisms, potentially informing new therapeutic strategies against this opportunistic pathogen.

What are the most effective methods for analyzing YidC-substrate interactions?

Several complementary techniques can be employed to analyze interactions between YidC and its substrate proteins:

  • Disulfide crosslinking: Introduce cysteine residues at potential interaction sites in both YidC and the substrate protein. After reconstitution, induce disulfide bond formation using oxidizing agents such as 5,5′-dithiobis-(2-nitrobenzoicacid) (DTNB), followed by detection via western blotting . This approach successfully identified interactions between YidC TM3 and the FOc substrate .

  • Co-purification and pull-down assays: Use affinity-tagged YidC to pull down interacting substrate proteins, which can then be identified by mass spectrometry or western blotting.

  • Fluorescence resonance energy transfer (FRET): Label YidC and substrate proteins with appropriate fluorophores to monitor real-time interactions and conformational changes during the insertion process.

  • Site-specific photocrosslinking: Incorporate photoreactive amino acids into YidC at potential interaction sites and identify crosslinked products after UV irradiation.

These methods can be complemented with structural studies (cryo-EM) and computational approaches (molecular dynamics simulations) to build a comprehensive model of YidC-substrate interactions.

How can researchers assess the impact of YidC mutations on membrane protein insertion efficiency?

To evaluate how specific YidC mutations affect membrane protein insertion efficiency, researchers can employ the following methodologies:

  • In vivo complementation assays: Express mutant YidC variants in a YidC-depletion strain (e.g., E. coli FTL10) and assess growth under permissive and non-permissive conditions . This approach has successfully identified residues critical for YidC function, including T362, Y517, Y370, Y377, and D488 .

  • Model substrate insertion assays: Monitor the insertion of well-characterized YidC-dependent substrates (e.g., FOc, Pf3 coat protein) in cells expressing mutant YidC variants. Assess insertion efficiency by:

    • Protease protection assays

    • Reporter fusions (alkaline phosphatase, GFP)

    • Membrane fractionation followed by western blotting

  • In vitro translation-insertion systems: Reconstitute the insertion process using purified components:

    • Purify wild-type and mutant YidC proteins

    • Prepare inside-out membrane vesicles or proteoliposomes

    • Perform coupled translation-insertion reactions with radiolabeled substrate proteins

    • Quantify insertion efficiency by protease protection and SDS-PAGE/autoradiography

By comparing the performance of wild-type and mutant YidC proteins across these assays, researchers can identify the specific steps in the insertion process affected by each mutation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.