Recombinant Burkholderia multivorans Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Peptidoglycan, also known as murein, is a crucial component of bacterial cell walls, providing structural integrity and protection against external stressors . Its synthesis involves coordinated action of enzymes that catalyze the insertion of new material into the pre-existing murein sacculus, which allows sacculi expansion to support cell growth . Murein polymerization requires transglycosylase (TGase) and transpeptidase (TPase) activities . TGase enzymes include the bifunctional class A penicillin-binding proteins (PBPs), the shape, elongation, division, and sporulation proteins (SEDS), and the monofunctional glycosyl transferases . This article focuses on the monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) found in Burkholderia multivorans, exploring its role in peptidoglycan synthesis and its potential implications for antibiotic resistance.

Peptidoglycan Synthesis and Transglycosylases

Peptidoglycan synthesis is essential for bacterial cell survival and involves multiple enzymes with transglycosylase (TGase) and transpeptidase (TPase) activities . TGases catalyze the polymerization of glycan strands, while TPases crosslink the peptide side chains, providing strength to the cell wall .

2.1. Types of Transglycosylases

There are several types of transglycosylases involved in peptidoglycan synthesis :

  • Bifunctional Class A Penicillin-Binding Proteins (PBPs): These proteins possess both transglycosylase and transpeptidase activities .

  • Shape, Elongation, Division, and Sporulation Proteins (SEDS): SEDS proteins are involved in cell shape determination, elongation, division, and sporulation .

  • Monofunctional Glycosyltransferases: These enzymes solely catalyze the glycosidic bond formation in peptidoglycan synthesis .

Burkholderia multivorans and Peptidoglycan Synthesis

Burkholderia multivorans is a Gram-negative bacterium known for its intrinsic resistance to multiple antibiotics . Peptidoglycan synthesis in Burkholderia species is crucial for cell survival, and enzymes involved in this process are potential targets for developing novel antibacterial agents.

Recombinant MtgA in Burkholderia multivorans

MtgA is a monofunctional peptidoglycan transglycosylase found in Burkholderia multivorans. As a monofunctional enzyme, MtgA solely catalyzes the transglycosylation step in peptidoglycan synthesis . The recombinant form of MtgA suggests that the gene encoding this enzyme has been cloned and expressed in a heterologous host for further study.

Role of MtgA in Peptidoglycan Structure

EnzymeFunction
TransglycosylasePolymerizes glycan strands by catalyzing the formation of glycosidic bonds between N-acetylmuramic acid and N-acetylglucosamine.
TranspeptidaseCrosslinks the peptide side chains of peptidoglycan strands, providing strength and rigidity to the cell wall. DD-TPases cleave the terminal peptide bond between the fourth and fifth amino acid of the donor pentapeptide (D-Ala 4-D-Ala 5) to form a new peptide bond .
LDT GoCatalyzes the creation of unconventional 1,3 peptidoglycan crosslinks .

MtgA and Antibiotic Resistance

The cell envelope of Gram-negative bacteria, including Burkholderia, acts as a barrier against antibiotics . Enzymes involved in peptidoglycan synthesis, such as MtgA, can influence antibiotic resistance. Perturbations in peptidoglycan synthesis can induce β-lactamase production, leading to resistance against β-lactam antibiotics .

Research Findings and Studies

Several studies highlight the importance of peptidoglycan synthesis and related enzymes in Burkholderia species:

  • Lytic Transglycosylases: Lytic transglycosylases in Burkholderia pseudomallei play a significant role in cell division, motility, and virulence .

  • Peptidoglycan Recycling: Peptidoglycan recycling is essential for fitness in the presence of β-lactams. Disruption of genes associated with peptidoglycan recycling affects bacterial survival .

  • β-Lactam Resistance: Burkholderia ubonensis exhibits intrinsic resistance mediated by an inducible class A β-lactamase .

  • L,D-Transpeptidases: A distinct family of L,D-transpeptidases catalyze L-Ala-mDAP crosslinks in peptidoglycan .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
mtgA; Bmul_2771; BMULJ_00466; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Burkholderia multivorans (strain ATCC 17616 / 249)
Target Names
mtgA
Target Protein Sequence
MVAVTGTQRTRVVSPTRWIVYAGAVFAAAWLATQLFYFVQIAMWSFVNPGSTAFMRTDAW WLSHDTPPAQIQHQWVPYDKISRNLKRAIIASEDATFATNNGYDVDAILQAWEKNKARGR IVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETLLDKERIFEIYLNSVEWGRGV YGAEAAARYYYRIPASRLGAWQSARLAVMLPKPRWFDAHRGSAYQAQRAAIIARRMGAAE LPQSE
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of mtgA in Burkholderia multivorans cell wall biosynthesis?

Answer: Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in B. multivorans plays an auxiliary but significant role in peptidoglycan synthesis by catalyzing the polymerization of lipid II to form glycan strands in the bacterial cell wall. Unlike bifunctional PBPs (Penicillin Binding Proteins) that possess both glycosyltransferase (GTase) and transpeptidase (TPase) activities, mtgA exclusively catalyzes glycosyl transfer reactions .

To study this function experimentally:

  • Generate recombinant mtgA protein using standard expression systems

  • Conduct in vitro peptidoglycan synthesis assays using radiolabeled lipid II

  • Analyze products by SDS-PAGE or HPLC to determine the length of glycan strands produced

  • Compare with known bifunctional PG synthases like PBP1A and PBP1B

Unlike essential transglycosylases, mtgA is generally dispensable under standard laboratory conditions but may become critical under specific environmental stresses .

How does the primary structure of B. multivorans mtgA compare to mtgA proteins in other Burkholderia species?

Answer: Comparative sequence analysis reveals high conservation of mtgA across the Burkholderia genus, particularly within the Burkholderia cepacia complex. Sequence alignment methodology indicates:

Burkholderia SpeciesAmino Acid Identity with B. multivorans mtgANotable Structural Features
B. vietnamiensis>90%Conserved catalytic domain structure
B. mallei>80%Similar N-terminal signal sequence
B. cenocepacia>90%Identical catalytic residues
Burkholderia sp. (strain 383)>90%Conserved YGAE motif in active site
  • Obtain mtgA sequences from protein databases (UniProt, NCBI)

  • Conduct multiple sequence alignment using tools like Clustal Omega or MUSCLE

  • Identify conserved catalytic residues and functional domains

  • Construct phylogenetic trees to visualize evolutionary relationships

The high sequence conservation suggests evolutionary pressure to maintain mtgA function across Burkholderia species that inhabit similar ecological niches, including the human respiratory tract in cystic fibrosis patients .

What are the optimal conditions for expressing and purifying recombinant B. multivorans mtgA protein?

Answer: Successful expression and purification of functional B. multivorans mtgA requires careful consideration of multiple parameters:

Expression system optimization:

  • Select an appropriate expression vector (pET or pBAD systems work well)

  • Test multiple E. coli expression strains (BL21(DE3), C41(DE3), Rosetta)

  • Optimize induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-30°C), and duration (4-18 hours)

Purification protocol:

  • Cell lysis: Sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Primary purification: Ni-NTA affinity chromatography for His-tagged constructs

  • Secondary purification: Size exclusion chromatography

  • Quality assessment: SDS-PAGE and Western blot analysis

Storage conditions:
Based on established protocols for Burkholderia proteins, store in Tris-based buffer containing 50% glycerol at -20°C or -80°C for extended storage. Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week .

Activity validation:
Confirm enzymatic activity using in vitro peptidoglycan synthesis assays with lipid II substrate, followed by HPLC analysis of the products .

How can researchers generate and validate mtgA knockout mutants in B. multivorans?

Answer: Generating and validating mtgA knockout mutants in B. multivorans involves several technical approaches:

Knockout generation methods:

  • Allelic exchange using suicide vectors (e.g., pEX18Tc or pJQ200)

  • Transposon mutagenesis approaches using mini-Tn5 (as described for E. coli studies)

  • CRISPR-Cas9 targeted mutagenesis (emerging method for Burkholderia)

Protocol overview:

  • Design constructs containing ~1 kb homologous regions flanking mtgA

  • Clone into appropriate suicide vector with antibiotic selection marker

  • Introduce into B. multivorans via triparental mating or electroporation

  • Select for single and double crossover events

  • Confirm deletion by PCR and sequencing

Validation strategies:

  • Genetic validation:

    • PCR confirmation of gene deletion

    • RT-PCR to confirm absence of mtgA transcript

    • Whole genome sequencing to rule out secondary mutations

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Cell morphology assessment by microscopy

    • Peptidoglycan composition analysis

    • Antibiotic susceptibility testing, particularly to cell wall-targeting antibiotics

  • Complementation studies:

    • Reintroduction of functional mtgA on plasmid

    • Analysis of phenotypic restoration

As demonstrated in similar studies with E. coli, mtgA deletion may lead to cell enlargement and altered polymer production , but phenotypes may differ in B. multivorans due to its unique cell envelope structure.

How does mtgA contribute to B. multivorans virulence in cystic fibrosis infections?

Answer: The contribution of mtgA to B. multivorans virulence in cystic fibrosis infections remains incompletely characterized, but several lines of evidence suggest important roles:

  • Cell wall integrity maintenance: As a peptidoglycan biosynthesis enzyme, mtgA helps maintain cell wall integrity under stress conditions found in CF airways (osmotic stress, antibiotic pressure, immune defense) .

  • Stress adaptation: Studies with related pathogens show that transglycosylases can be upregulated during infection. For example, in Brucella species, mtgA upregulation during infection correlates with virulence, and knockout mutants show lower virulence in mouse infection models .

  • Host immune interaction: Peptidoglycan fragments generated by transglycosylases can be immunogenic. Immunoproteomic analyses of Burkholderia species have identified several cell wall-associated proteins as immunoreactive in CF patients .

  • Antibiotic resistance: B. multivorans exhibits intrinsic resistance to many antibiotics, including those targeting cell wall synthesis. The cell wall architecture maintained by mtgA may contribute to this resistance profile .

To study mtgA's role in virulence:

  • Generate mtgA deletion mutants in clinical B. multivorans isolates

  • Compare wild-type and mutant phenotypes in infection models:

    • Galleria mellonella larvae survival assays

    • Adhesion to lung epithelial cells

    • Biofilm formation under CF-mimicking conditions

    • Resistance to antimicrobial peptides and antibiotics

  • Conduct transcriptomic analysis of mtgA expression during infection

  • Perform in vivo competition assays between wild-type and mtgA mutants

Does mtgA expression in B. multivorans change during adaptation to the cystic fibrosis lung environment?

Answer: Evidence suggests that B. multivorans undergoes significant adaptation during chronic cystic fibrosis infection, including potential modifications in cell wall biosynthesis proteins like mtgA:

  • Genomic analysis of sequential isolates: Studies of B. multivorans ST-742 isolates from CF patients over a ten-year period reveal distinct genomic profiles, suggesting adaptive evolution within the host environment .

  • Stress response regulation: The OmpR regulator in B. multivorans controls mucoid-to-nonmucoid morphotype transition and envelope remodeling under stress conditions . As a cell envelope component, mtgA activity may be influenced by this regulatory network.

  • Adaptation metrics: Changes in mtgA expression could be linked to:

    • Antibiotic resistance development

    • Biofilm formation capacity

    • Colony morphology transitions

    • Growth rate alterations

Methodological approach for investigation:

  • Collect sequential clinical isolates from CF patients over time

  • Perform transcriptomic and proteomic analysis to quantify mtgA expression

  • Sequence the mtgA gene and promoter region to identify mutations

  • Correlate expression changes with phenotypic adaptations

  • Use reporter gene fusions to monitor mtgA expression under CF-mimicking conditions

This approach would reveal whether mtgA undergoes regulatory changes during chronic infection, potentially contributing to B. multivorans persistence in the CF lung environment.

How does B. multivorans mtgA function differ from E. coli mtgA in peptidoglycan synthesis?

Answer: B. multivorans mtgA and E. coli mtgA share homology but exhibit important functional differences:

Structural comparison:

  • B. multivorans mtgA shares approximately 60-70% sequence identity with E. coli mtgA

  • Both belong to the GT51 glycosyltransferase family

  • Key catalytic residues are conserved, but species-specific differences exist in non-catalytic regions

Functional differences:

  • Essentiality: In E. coli, mtgA is definitively non-essential, allowing for viable knockout mutants that display cell enlargement . B. multivorans mtgA essentiality has not been conclusively determined but is likely also dispensable.

  • Physiological effects: E. coli mtgA deletion leads to increased cell diameter without affecting polar axis length, resulting in "fat" rather than "tall" cells . These morphological changes enhance polymer production. The phenotypic consequences of B. multivorans mtgA deletion remain to be characterized.

  • Enzyme kinetics: While both enzymes catalyze the same reaction, their optimal conditions likely differ based on the distinct cell envelope composition of each organism.

Experimental approach to compare:

  • Express both enzymes recombinantly

  • Conduct parallel in vitro activity assays under identical conditions

  • Compare substrate specificity using lipid II variants

  • Perform complementation experiments to test functional interchangeability

These differences may reflect adaptation to the distinct ecological niches and cell envelope requirements of these bacterial species.

How does the species-specificity of GltJK as a translocation factor affect experimental design when studying B. multivorans mtgA?

Answer: The species-specificity of GltJK as a translocation factor has significant implications for experimental design when studying B. multivorans mtgA:

Background on GltJK specificity:
Research has shown that in the Burkholderia cepacia complex, GltJK components (part of a predicted ABC-type transporter) are required for the entry of certain proteins into recipient cells. Importantly, despite >60% sequence identity between B. multivorans and E. coli GltJK, only the Burkholderia version functions with Burkholderia-specific substrates .

Experimental design considerations:

  • Expression system selection:

    • When expressing B. multivorans mtgA in heterologous systems, consider co-expressing B. multivorans GltJK if translocation is required

    • E. coli expression systems may not correctly process or localize B. multivorans mtgA

  • Complementation studies:

    • When complementing mtgA mutants, ensure compatibility with native translocation machinery

    • Cross-species complementation may fail despite protein expression

  • Protein-protein interaction studies:

    • Design experiments to account for potential species-specific interactions

    • Use pull-down assays with species-matched components

  • Functional assays:

    • Include species-matched controls in translocation experiments

    • Consider domain-swapping experiments to identify species-specific regions

This species-specificity highlights the importance of using matched cellular components when designing experiments involving B. multivorans cell envelope proteins and avoiding assumptions based solely on sequence homology with E. coli counterparts .

How can structural information about B. multivorans mtgA be leveraged for antibiotic development against cystic fibrosis pathogens?

Answer: Targeting B. multivorans mtgA for antibiotic development presents both opportunities and challenges that require sophisticated structural biology approaches:

Structural characterization strategies:

  • X-ray crystallography of purified recombinant B. multivorans mtgA

  • Cryo-EM analysis of mtgA in complex with substrate analogs

  • NMR spectroscopy for dynamic binding studies

  • Molecular dynamics simulations to identify binding pockets

Drug development pipeline based on structural data:

  • Structure-based virtual screening:

    • In silico docking against mtgA active site

    • Fragment-based drug discovery approach

    • Identification of allosteric binding sites

  • Rational drug design:

    • Development of substrate analogs as competitive inhibitors

    • Design of transition state mimics

    • Creation of covalent inhibitors targeting conserved catalytic residues

  • Selectivity considerations:

    • Exploit structural differences between bacterial and human glycosyltransferases

    • Target Burkholderia-specific features not present in commensal bacteria

    • Design combination therapies targeting multiple cell wall synthesis enzymes

  • Experimental validation:

    • Enzymatic inhibition assays

    • Minimum inhibitory concentration (MIC) determination

    • Efficacy testing in infection models

    • Resistance development assessment

Challenges to address:

  • The dispensable nature of mtgA may limit efficacy as a single target

  • Potential redundancy with bifunctional transglycosylases

  • Species-specific differences requiring narrow-spectrum approaches

  • Penetration through the complex B. multivorans cell envelope

This approach aligns with the urgent need for new antimicrobials against intrinsically resistant pathogens like B. multivorans that cause persistent infections in cystic fibrosis patients .

What methodologies can resolve contradictory data regarding mtgA function in bacterial cell wall synthesis?

Answer: Resolving contradictory data regarding mtgA function requires rigorous methodological approaches:

Sources of contradictions in mtgA research:

  • Differences between in vitro and in vivo findings

  • Species-specific variations in mtgA function

  • Conflicting phenotypic observations in different growth conditions

  • Variable methodologies across research groups

Resolution methodologies:

  • Statistical meta-analysis approach:
    Similar to the approach described for resolving experimental conflicts in cognitive linguistics , statistical meta-analysis can be applied to mtgA functional studies by:

    • Comparing effect sizes across similar experiments

    • Achieving robust synthesis of experimental data

    • Revealing potential causes of divergent outcomes

    • Establishing confidence intervals for phenotypic effects

  • Standardized experimental protocols:

    • Develop consensus methods for mtgA activity assays

    • Establish reference strains and constructs

    • Create repositories of validated reagents

    • Implement blinded analysis of phenotypic outcomes

  • Multi-laboratory validation studies:

    • Conduct parallel experiments across different laboratories

    • Use identical protocols, reagents, and analytical methods

    • Compare results through centralized data analysis

    • Publish comprehensive datasets including negative results

  • Integrated multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate mtgA expression with cell wall composition

    • Map genetic interactions through synthetic lethality screens

    • Develop mathematical models of cell wall biosynthesis

  • Experimental design considerations:

    • Control for strain background effects

    • Account for growth phase-specific regulation (as observed with other cell wall enzymes)

    • Test multiple environmental conditions relevant to natural habitats

    • Consider post-translational regulation mechanisms

By implementing these methodologies, researchers can systematically address contradictions in the literature and develop more robust models of mtgA function in bacterial cell wall synthesis.

How does collateral sensitivity in B. multivorans influence experimental design when studying mtgA function?

Answer: Collateral sensitivity (CS) in B. multivorans presents both challenges and opportunities for experimental design when investigating mtgA function:

Background on collateral sensitivity:
B. multivorans exhibits collateral sensitivity patterns wherein acquired resistance to one antibiotic results in decreased resistance to another non-treatment antibiotic . This phenomenon creates a complex adaptive landscape that must be considered when designing experiments targeting cell wall biosynthesis enzymes like mtgA.

Experimental design considerations:

  • Antibiotic selection pressure experiments:

    • Design evolution experiments with awareness of CS networks

    • Monitor mtgA expression changes during resistance development

    • Evaluate cross-resistance and collateral sensitivity patterns in mtgA mutants

    • Consider antibiotic cycling strategies based on established CS networks

  • Interpretation of resistance phenotypes:

    • Distinguish between direct effects on mtgA and compensatory adaptations

    • Account for pleiotropic effects when measuring fitness costs

    • Consider epistatic interactions with other resistance mechanisms

  • Robust controls:

    • Include multiple reference strains with defined resistance profiles

    • Test several classes of cell wall-targeting antibiotics

    • Measure cross-resistance patterns systematically

  • Methodological approach:

    Experimental StepConsideration for CS
    Mutant generationAvoid selection markers that could trigger CS
    Growth conditionsTest in presence of sub-inhibitory antibiotic concentrations
    Phenotype assessmentMeasure susceptibility to multiple antibiotic classes
    Fitness measurementEvaluate in competition with wild-type under various conditions
    Transcriptional analysisMonitor global responses, not just mtgA
  • Translational applications:

    • Leverage CS networks to design more effective combination therapies

    • Identify sensitizing mutations that could be targeted alongside mtgA inhibition

    • Develop cycling strategies to prevent resistance development

Understanding these complex adaptive responses is critical for accurately interpreting experimental results involving cell wall biosynthesis enzymes like mtgA in B. multivorans and may inform new therapeutic approaches for treating cystic fibrosis infections .

What are the primary unanswered questions regarding B. multivorans mtgA that present opportunities for novel research?

Answer: Several critical knowledge gaps regarding B. multivorans mtgA present significant research opportunities:

  • Structural characterization:

    • No crystal structure exists specifically for B. multivorans mtgA

    • Substrate binding mechanisms remain uncharacterized

    • Species-specific structural features are undefined

  • Regulatory networks:

    • How environmental cues modulate mtgA expression during infection

    • Connection between the OmpR regulatory system and mtgA function

    • Post-translational control mechanisms affecting enzyme activity

  • Functional redundancy:

    • Relationship between monofunctional mtgA and bifunctional PG synthases

    • Compensatory mechanisms following mtgA deletion

    • Conditions where mtgA becomes essential for viability

  • Role in pathogenesis:

    • Contribution to antibiotic resistance mechanisms

    • Function during biofilm formation in CF lung environment

    • Involvement in persistence during chronic infection

    • Interaction with host immune defenses

  • Therapeutic targeting:

    • Inhibitor development specific to B. multivorans mtgA

    • Sensitization strategies to enhance antibiotic efficacy

    • Combination approaches targeting multiple cell wall enzymes

These research gaps represent promising directions for investigators seeking to advance understanding of this important enzyme and potentially develop new therapeutic approaches for B. multivorans infections in cystic fibrosis patients.

What technological advances are needed to better characterize the function of mtgA in B. multivorans?

Answer: Several technological advances would significantly enhance our ability to characterize mtgA function in B. multivorans:

  • Improved genetic manipulation tools:

    • CRISPR-Cas9 systems optimized for Burkholderia species

    • Inducible gene expression systems with tight regulation

    • Site-specific integration systems for single-copy complementation

    • Transposon libraries with higher coverage for forward genetic screens

  • Advanced imaging technologies:

    • Super-resolution microscopy techniques to visualize peptidoglycan synthesis in live cells

    • Fluorescent D-amino acid labeling optimized for B. multivorans

    • Cryo-electron tomography of intact cell envelopes

    • Single-molecule tracking of fluorescently tagged mtgA

  • Structural biology approaches:

    • Improved crystallization techniques for membrane-associated enzymes

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

    • Advanced homology modeling incorporating species-specific features

    • Computational prediction of protein-protein interaction networks

  • Systems biology integration:

    • Multi-omics approaches linking genotype to phenotype

    • Machine learning algorithms to identify patterns in complex datasets

    • Mathematical models of cell wall biosynthesis specific to Burkholderia

    • Network analysis tools to map interactions between cell envelope components

  • Ex vivo and in vivo models:

    • Artificial sputum media that better mimics CF lung environment

    • Microfluidic devices to study bacterial growth under defined gradients

    • Improved animal models that recapitulate human CF lung conditions

    • Organoid culture systems derived from human CF airway epithelium

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.